SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019180 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019180
Domain Number 1 Region: 269-366
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 430-721
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000000068
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 3 Region: 191-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000653
Family I set domains 0.048
Further Details:      
 
Domain Number 4 Region: 16-70
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000263
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 5 Region: 110-187
Classification Level Classification E-value
Superfamily EF-hand 0.000000000214
Family Calmodulin-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019180   Gene: ENSTNIG00000016089   Transcript: ENSTNIT00000019408
Sequence length 777
Comment pep:novel chromosome:TETRAODON8:7:8899319:8946083:1 gene:ENSTNIG00000016089 transcript:ENSTNIT00000019408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCRRTYCGRGRQCAVMAETGRAECVCQEKCRPSFVPVCGSDGRFYENHCEVYRTACLERR
RIYVVHSKDCFFKGNACTMSEYNRLKSTLLNMQPKLLKLGEQDQQRDMEEKRALVDTMFK
YLDVDQDGWLVSDELEKVSMKEHMEDNLLECTMQDLLRYDDYNNDGHLSLHEFYTAFQVV
QLSLAEDQRISVSTVTVGLSAVLTCAIQGTLRPPIIWKRNGIILNFLDLEDINDFGDDGS
LYITKVTTIHMGNYSCHAYGYEDLCQTHVLQVNVPPVILVYPETQAQEPGVSASLHCHAD
GIPNPNLLWLKNGLELQPRSSKQLSLIANGTELLISSVRYEDTGAYTCIAKNEVGVDEDI
SSLFVEDSAKKTLANILWREEGLSVGNMFYVFSDEGITVLQPSECEIRRHMKRTERIVAT
YDEMCPKGEGVSPQHCVWSSAVNVRDKYIYVTQPLLSRLLVVDIQAQKVVQAISTDPFPV
KMLYDKSHDQVWVMTWGDMEKTHPTLQVIPQASVGEVHRAIRTTFQRVTDFFIPPTNLII
THVRFAFVFLKNEPAVHKIDLETFHRVKTISLKNYSCIPVSMAYTHLSGFYFVQCQSKSR
LQAPPQLLIDSVTDAVIGPNLNVSGRPFVSPDGRYIVTPDPRSSKLMVQTVSFQGELSLN
QELDEPFVISDVAFQPSFVESNQHVVVATSGSGTDFLFADLSSGLVEVLRSLKEPLAPQA
WPWGGPNRVVVSSGLFGQYLVTPSAESLFILNGKQRTPHCEVSDIKRGNTVVWVGEV
Download sequence
Identical sequences H3DF86
99883.ENSTNIP00000019180 ENSTNIP00000019180 ENSTNIP00000019180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]