SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019274 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000019274
Domain Number - Region: 39-160
Classification Level Classification E-value
Superfamily E set domains 0.000378
Family Arrestin/Vps26-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019274   Gene: ENSTNIG00000016183   Transcript: ENSTNIT00000019503
Sequence length 333
Comment pep:novel chromosome:TETRAODON8:16:2845374:2847076:-1 gene:ENSTNIG00000016183 transcript:ENSTNIT00000019503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFFSFGQSAEIDVILNDAETRKKAEHKTEDGKKDKYFLFYDGETVSGKVNVTLKNPGKR
LEHQGIKIEFVGQIELYYDRGNHHEFVSLVKDLARPGEITQSQTFDFEFTHVEKPYESYT
GQNVKLRYFLRATVIRRLNDISKELDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPSVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYDLTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEITLWRKGDVVR
KSMSHQAVVASQRFEGSAASESALEQAAKEESG
Download sequence
Identical sequences H3DFI0
ENSTNIP00000019274 ENSTNIP00000019274 99883.ENSTNIP00000019274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]