SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019310 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019310
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.41e-40
Family Rhodopsin-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019310   Gene: ENSTNIG00000016217   Transcript: ENSTNIT00000019539
Sequence length 226
Comment pep:novel chromosome:TETRAODON8:16:3781367:3782047:-1 gene:ENSTNIG00000016217 transcript:ENSTNIT00000019539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVLLAIAWCKELHQPMFILLFSLPISDMIGATAFFPQLLWSIATQNSSIPYAACFIQAY
LLHVYGTGNLVILSVMAYDRYIAICFPLRYHEILSPLTLVKMILSVWVITLSVIGSVFLL
HKQYKICRTNIVDFYCNNPSLLKLMCGETNVSNYYGLVSIVLVQGAPLAMMVYTYAQILY
VCVSTKSTDARKKAIQTCSSHLLVYILLRKYDYRVFIDLFIHGVMG
Download sequence
Identical sequences Q4RRN3
ENSTNIP00000019310 99883.ENSTNIP00000019310 ENSTNIP00000019310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]