SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019360 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019360
Domain Number 1 Region: 88-332
Classification Level Classification E-value
Superfamily BEACH domain 8.5e-93
Family BEACH domain 0.0000000013
Further Details:      
 
Domain Number 2 Region: 441-697
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-33
Family WD40-repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 3-82
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-16
Family PreBEACH PH-like domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019360   Gene: ENSTNIG00000016266   Transcript: ENSTNIT00000019589
Sequence length 710
Comment pep:novel chromosome:TETRAODON8:16:4840009:4866212:1 gene:ENSTNIG00000016266 transcript:ENSTNIT00000019589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIMRQGEIFLQLAGSAHAPVLAYTEGLHGKWMFSEIRAIFSRRYLLQNTAMEVFMANRT
SVMFSFRVQTSVKKVVDSVPRVGVGTSYGLPQARRVSLATPRQLFKSSNMTQRWQRREIS
NFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPVGALNPKRA
AFYAKNYEKWESEQAPPYHYSSHYSAAASTLHWLVRIEPYTTFFLCANNHKFDHPERCFS
SISRSWRNCQRDTSDVKELIPEFFYLPEMFVNSNGYNLGTREDRITVSDVELPAWAKKPE
DFIRINRMATEAQIQHFGQTPSQLLIEPHPPRSSAMHLSPLMFKDQMQQDVIMVLKFPSN
SPVTHVAANTLPHLTVPAVVTVTCSRLFAVNRWNNTVGLRGAPGYSLDQAHHLPIEMDSL
VANNAGSNKRQITDLVDQSIQITSHCFVVTADNRYILVCGFWDKSFRVYSSETGKLTQIV
FGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNTHNGDYPAPRAVL
TGHDQEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEAPDHFQQPRIISVSSEGH
CIVCYDRGRFCNFSINGKLLAQMEVSDSTKAIVLSSDGHNLVTGGDNGVVEVWQACDFKQ
LYVYPGCDAGIRAMDLSHDQRTLITGMVSGSIVAFNIDFNRWHHEHQNRY
Download sequence
Identical sequences Q4RRG6
ENSTNIP00000019360 99883.ENSTNIP00000019360 ENSTNIP00000019360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]