SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019366 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019366
Domain Number 1 Region: 487-745
Classification Level Classification E-value
Superfamily NHL repeat 7.06e-47
Family NHL repeat 0.00000973
Further Details:      
 
Domain Number 2 Region: 329-422
Classification Level Classification E-value
Superfamily E set domains 1.13e-20
Family Filamin repeat (rod domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 113-174
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000641
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 19-88
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000111
Family RING finger domain, C3HC4 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019366
Domain Number - Region: 157-240
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019366   Gene: ENSTNIG00000016272   Transcript: ENSTNIT00000019595
Sequence length 747
Comment pep:novel chromosome:TETRAODON8:16:4941921:4945793:-1 gene:ENSTNIG00000016272 transcript:ENSTNIT00000019595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRESTSSSPVVRQIDKQFLVCSICLDHYHNPKVLPCLHTFCEKCLQNYIPPQSLTLSC
PVCRQTSILPEKGVAALQNNFFITNLMEVLQRDPECSRPEACNVLESASAATACQPLSCP
NHEGKVMEFYCESCETAMCLECTEGEHREHVTVPLRDVLEQHKSVLKNQLDTVRNRLPQL
TAAIELVNEISKQLSDRKNQAVMEISHTFDELEKALHQRKTALVTEVENICNTKQKVLQD
QLGALLLGKENIQSSCNFTEQALSHGSATEVLLVQKQMGERVSALARHSFPEHPHENGHL
ECQVETDGLRRSIQNLGVLITTGAVGHTSVATGEGLRHALVNQHTTVTVTTKDKDGELVK
TGNAALRAEILSADGTCTEAEVVDNKNGTYEVGYTIRSEGEFTFSLLLYEQPVRGSPFRL
RAVKPSDVLQSPDDVKRRVKSPSGGGGHVRQKAVRRPSSMYSTTKKKENPIEDELIYRVG
TRGRDKGEFTNIQGISASSNGRIVVADSNNQCIQVFSNDGQFKMRFGVRGRSPGQLQRPT
GVTVDMNGDIIVADYDNRWISIFSSDGKFKNKIGAGRLMGPKGVAVDKNGHIITADNKAC
CVFIFQSNGKLVTKFGARGTSDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYNADGEFLF
KFGSHGEGNGQFNAPTGVAVDTNGNIIVADWGNSRIQVFDSSGSFLSYINTSADPLYGPQ
GLALTSDGHVAVADSGNHCFKVYRYLQ
Download sequence
Identical sequences H3DFS2
ENSTNIP00000019366 99883.ENSTNIP00000019366 ENSTNIP00000019366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]