SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019382 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019382
Domain Number 1 Region: 588-848
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-93
Family Eukaryotic proteases 0.0000039
Further Details:      
 
Domain Number 2 Region: 334-444
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-25
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 217-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-23
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 4 Region: 77-163
Classification Level Classification E-value
Superfamily SEA domain 5.49e-16
Family SEA domain 0.0096
Further Details:      
 
Domain Number 5 Region: 522-556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 449-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 485-519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 563-599
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000564
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019382   Gene: ENSTNIG00000016289   Transcript: ENSTNIT00000019612
Sequence length 849
Comment pep:novel chromosome:TETRAODON8:16:5136221:5142175:-1 gene:ENSTNIG00000016289 transcript:ENSTNIT00000019612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYMDSGLRYTPKTVSDKEWESSVQFLPASDNTKLEKKKGPGKTGAVIGVVILAVVVALM
IGLLVWHFRFRQDIRVKKVYTGSMRITNQVFENAYEDSNTTEFKALAKQVVTQLKTIYSK
SPQLAKYYVGSTVQAFSEGSVVAYYLSEFRVPVGQEAAVDKAMAAMEQLVNKEQRSVYRA
GNSLMFDNVVSSALDTRMTSASFSRSLQFSEHAKPNYIGQIQSPGFPNHPYSPNTLVQWR
LRADPDYVIQLKFDTINLENNCTNDFIRIYDSLVSIESRIMDELCGYHSPSEPMTFISSG
NVLLVAMATNDMKNYPGFRAQVSQVKRGSPATVCGGKLSGENGKFTSPNFPNYYPARISC
QWTIQVPAGKVVKVKFRKFLLFEPGQERVKNCPKDYVQINGKKVCGEQPDWAVTETSSTN
TMDVLFVSDSSHVDRGFEAEFQAVDADNLCPNKFQCRNQRCIKSELQCDGWNDCGDMSDE
VNCKCNSKDITCKNGLCKPMFWKCDGVDDCGDKTDEQNCGDCPTGQFKCQNKKCISEKNQ
CDSRDDCGDGSDEINCGRNTDAKCTDLTYRCSNNKCITKVNPECDGTPDCEDGSDEVNCG
CGKNVFRTSRIVGGEVADEGEFPWQVSLHIKNRGHVCGASIISPNWLVTAAHCVQDEGTL
RLSQPGSWEAYLGLHVQQNIKKSVVVRNLKRIIPHPNYNEYTYDNDVALMELDSPVTYSD
YIQPICLPAPQHDFPVGETVWITGWGATREEGPAATVLQKAQVRIINQDTCNSLMGGQIT
SRMLCAGVLTGGVDACQGDSGGPLSSPTGNQMFLAGVVSWGEGCARRNKPGIYTRVTKYR
AWIKEKTGV
Download sequence
Identical sequences H3DFT8
ENSTNIP00000019382 99883.ENSTNIP00000019382 ENSTNIP00000019382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]