SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019383 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019383
Domain Number 1 Region: 336-526
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 4.05e-83
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000862
Further Details:      
 
Domain Number 2 Region: 9-102
Classification Level Classification E-value
Superfamily A heparin-binding domain 4.05e-41
Family A heparin-binding domain 0.00000615
Further Details:      
 
Domain Number 3 Region: 103-166
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 2.22e-25
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0001
Further Details:      
 
Domain Number 4 Region: 267-324
Classification Level Classification E-value
Superfamily BPTI-like 3.26e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019383   Gene: ENSTNIG00000016290   Transcript: ENSTNIT00000019613
Sequence length 728
Comment pep:novel chromosome:TETRAODON8:16:5144635:5158447:-1 gene:ENSTNIG00000016290 transcript:ENSTNIT00000019613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANAGTGFAVAEPQVAMFCGKLNMHVNIQTGRWEPDPSGTQSCVGTKEGVLQYCQEMYPEF
QITNVVEADQSIRIENWCKKKKVCKGHAHVVVPYKCLVGEFVSDILLVPEKCKFFHKERM
DMCVSHQQWHGVAKEACSKSSMVLHTTAVASCGIDKFHGTEYVCCPSSQAGASAVRPEDD
EDEEIENEEIDEADLVEEENSEAPADEQPTQSKMSESQEDKTLQEVTIRINHPAFSLMKP
VCRRSEECLSGRSRIDAGVSGPDAVPLTEVCTLEPETGPCRASMPRWHFDMNQKKCVHFI
YGGCAGNRNNFDSEEYCMAVCKRLITVPTPQPTDDVDIYFETPADDKEHSRFQRAKEQLE
IRHRSRMERVRKEWEEADRQAKNLPKAERQTLIQHFQAMVESLEEEAASEKQQLVETHLA
RVEAMLNDRRRLALENYLAALQADPPRPHRILQALRRYVRAENKDRQHTIRHYQHVLAVD
PEKAAQMKSQVMTHLHVIEERMNQSLSLLYKVPYVADEIQDEIDELLQEQKTDMDQFLSS
ISESQPDITVSSEESVEVSVSEGKPYRPFQVTSLGSRSEAEDSPRAFKKGSAMSGLDGLI
GAEERIINSKTKINGNTVIDESLDVKEVVYSAERVSVIHDDEPESYRPLGEDFSFGSSAL
IGLLVIAVAIATVIVISLVLLRKRQYGTISHGIVEVDPMLSPEERHLSKMQNHGYENPTY
KYLEQMQI
Download sequence
Identical sequences H3DFT9
ENSTNIP00000019383 ENSTNIP00000019383 99883.ENSTNIP00000019383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]