SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019582 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019582
Domain Number 1 Region: 161-355
Classification Level Classification E-value
Superfamily E set domains 1.77e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000138
Further Details:      
 
Domain Number 2 Region: 57-177
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.55e-21
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019582   Gene: ENSTNIG00000016483   Transcript: ENSTNIT00000019812
Sequence length 492
Comment pep:novel chromosome:TETRAODON8:2:14676574:14689347:-1 gene:ENSTNIG00000016483 transcript:ENSTNIT00000019812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRKKFGDDYQVVTTSSSGSGFSQPPPEKKKKRQRFVDKNGRCNVQHGNLGGETSRYL
SDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWFIAYIRGDLNKAHNDKYTPCVANVY
NFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPK
KRAETLMFSEHAAISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQ
LELDVGFSTGADQLFLVSPLTICHVIDTKSPFYDLSQRSMQTEQFEIVVILEGIVETTGM
TCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEALLLS
SPLMAPSLCNSGEKNSSLDCLETLEDNDSTTKLPTKLQKITGRDGLPKKLLRMSSTTSEM
TYSFGDLPMKLQRISSVPGVSDDKQVGKASKINTEPMSKSVADLPPKLQRLAGGGRMDGH
LPPKLRKMNSDR
Download sequence
Identical sequences H3DGD8
ENSTNIP00000019582 99883.ENSTNIP00000019582 ENSTNIP00000019582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]