SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019670 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019670
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-23
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019670   Gene: ENSTNIG00000016570   Transcript: ENSTNIT00000019900
Sequence length 924
Comment pep:novel chromosome:TETRAODON8:17:4446769:4465635:1 gene:ENSTNIG00000016570 transcript:ENSTNIT00000019900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYPDGLPSDFSIIATFKVTEDTAGKSWDLWQVSDPEGKEQVGLRFHGDTRSLDFFYTSPH
TRKMVRTFSGVERVFDGEWHKLALSVKADQVKLLIDCQEVKVESVDQLRPVVLPGYTSIV
KRASGDRSMSVDLQQMEVSCDPEKVHSEGCCELSSVKCLNPDVADSVEAMQSWWTTGHSR
TSKAKSKRENLREPGQAAQNELFLTSCFIHPQGHRGLPGEPGDAGRRGNWLVSGSGGNKG
IRGRTGHYGNVGEPGPKGDRGPKGLKGLKGAAGFKGVRGPPGEKGEKGDAGYEGIPGFQG
VKGVKGTAGVSGRAGRRGKQGIIGDPGLSGRDGDPGIEAYQGPQGLRGKIGQSGVKGPRG
YKGSAGKPGRPGFIGPPGPTGEKGSKGPKGKMGGRGEQGRQGRRGKRGPAGPAGQSGPVG
TKGVRGEGGPDGFQGPPGPPGDVPMGAPGPPGQKGPPGPPGDPGYEGAEGELGPPGFYGE
AGEPGREGETGLPGRPGRAFDGQPGKPGERGHVGKPGLRGHPGLRGPPGVGIPGIRGSPG
LPGSPGAEGPRGPNGYKGEPGRPGVSGEKGMAGLPGAPGKPGEKVMMLIIQACKSKTQML
KMICSEFQSGTKGSEGLKGQMGLTGRPGQQGGKGNPGPPGPLGFPGKPGLTGRDGAAGIP
GRPGLKGEAGAAGIPGVDGMPGMPGSAGLHGQKGDAGLPGSKGTKGSAGPPGHAGLPGAT
GLKGSTSYFGVYFLNVSFAIKGSKGETGSPGIQGTPGSVGRAGEAGRAGQPGHPGMPGLK
GSKKGSTGEPGQRGQEGQMGISGQPGLPGPPGPRGLMGDTGLPGAPGPTSQPGSPGLPGP
AGPQGPRGLPGIIGPRGQPGWPGRPGFNGQRGEPGVGGEKGSPGRSMTGDPGPPGAPGPP
GKPGPPGPNGAEGKRGSPGIPGRP
Download sequence
Identical sequences H3DGM6
99883.ENSTNIP00000019670 ENSTNIP00000019670 ENSTNIP00000019670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]