SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019680 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019680
Domain Number 1 Region: 91-140
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000011
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 2 Region: 144-199
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000405
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 199-254
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000107
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 4 Region: 43-74
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019680
Domain Number - Region: 617-881
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0412
Family Rhodopsin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019680   Gene: ENSTNIG00000016580   Transcript: ENSTNIT00000019910
Sequence length 1243
Comment pep:novel chromosome:TETRAODON8:17:4091700:4134351:-1 gene:ENSTNIG00000016580 transcript:ENSTNIT00000019910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYGMIGQHTVKSQRPRSVHDTKALQEQAESAKFMAQTGESGADEWSQWNLCSVTCQGSQV
RTTTCVSPYGTPCLTLIQTLKKPDAFSVSAVHGVWEEWSPWSLCSFTCGRGHRTRTRMCA
PPQHGGRACDGPETQTKLCNIALCPVDGQWQEWSSWSDCSVTCANGTQQRTRQCSAAAHG
GSECRGHWAESRECHNPDCTANGQWNPWGPWSGCSKSCDGGWQRRARVCQGAAVTGQQCD
GSGEEVRKCSDQRCPAPYEICPEDYAVSMVWRRTPSGELAFNRCPPNATAGTTSRRCSLD
HRGMAFWEQPSYARCITNEFRYLQQSVQGHLAKGQRMLAGDGMSQVTKNLLDLTQRRNFY
AGDLLSSVEILRNVTETFKRASYEPSSDDVQNFFQIISNLLEEENKEKWEDAQKIYPGAV
ELMQVIEEFIHIVGLGMKDFHNAYLMTGNLVASIQRLPAVSVMTDINFPMKGRKGMVDWA
RNSEDKVVIPKGLFVSQSADMEGSPVFILGTVLYKTLGLMLPSPKNHTVVNSKVIAVTVR
PEPKATESQLEIELAHITNGTMGPYCALWDSTIMNDSWGAWSTKGCKTVLTDASHTKCLC
DPVSTFAILAQQPREITMEYSGVPSVTLIVGCGLSCLALITLAVIYAVLWRYIRSERSII
LLNFCLSIVCSNILILVGQTQTHNMGVCIMTTAFLHFFFLASFCWVLTEAWQSYMAVTGK
VRTRLIRKRFLCLGWEGLPALVVAVSMGFTKTKGYGTPLYCWLSLEGGLLYAFVGPAAAV
VLVNMVIGILVFNKLVSRDGILDKKLKHRAGASLWSSCVVLPLLALTWMSAVLAMTDKRS
ILFQILFAVFDSLQGFVIVMVHCILRREVQDAFRCRLRNCQDPISGDATGTFPNGHAQIM
TDFEKDVDIACRSALHKDMGSCRAATITGLSRISLNDEEEEKAPEGLNYSTLPGNIMSKV
IIQPSALHMPMGVGDLKEQCMADSNADMRRTVYLCTDDTMRQSEHDMEGHPVAAQMMETD
YIVMPRASAAAVSGPCNASTLLKDDSKMNIPMDALQHERLMHCKMSPDFNIGPSGMDHMN
VNLEQHYPSAPEQMQNLPFEPRTAVKNFLAEMEESAGLSRSETGSTISMSSLERRKSRYS
DLDFEKVMHTRKGKMRVFQKQAAMFATLNAANRDGAGEQIQDKTMPNKNPWESYNPACEY
QNYATMNVLQSDTKDSLEMTPAEWEKCVNLPLDVQEGDFQTEV
Download sequence
Identical sequences H3DGN6
ENSTNIP00000019680 ENSTNIP00000019680 99883.ENSTNIP00000019680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]