SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019747 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019747
Domain Number 1 Region: 204-244
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019747   Gene: ENSTNIG00000016641   Transcript: ENSTNIT00000019977
Sequence length 447
Comment pep:novel chromosome:TETRAODON8:17:2511103:2519398:1 gene:ENSTNIG00000016641 transcript:ENSTNIT00000019977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLAAELLLLLGLLLLTLHITVLRSSPLPQGNGNASLDQDAALREQNSINAKSSSSTKL
APEERRSGPEHRLAHRPSSLPWAPGGSVRRDGPGAFLLDLHNFPDLSKADISRQNPNIQV
VTIEVVDGLESHETEKGLRKERKPNWRNWWPHSSSFPTRHNEEHDHNYGGNNENSNFLRP
STDWDRRGGGGKAQTEYDYMDGEGDWSNWSVCSVTCGNGNQKRTRSCGYACTATESRTCD
MPTCPGIEDAFRTAATEVSLLAGTNEFNATELFGVDTDSCERWMNCKSDFLKKYMTKVAN
DLPSCPCAYPTEVAYSSADVHDALTRRDFRWKDASGPKEKLEIYKPTARYCIRSMLTLES
TTLAAQHCCYDDGMKLITRGKGAGTPNLISTEFSADLHYKVDILPWIICKGDWSRYNQAR
PPNNGQKCPNNPQDEDYYKQFEEAREF
Download sequence
Identical sequences H3DGV3
ENSTNIP00000019747 99883.ENSTNIP00000019747 ENSTNIP00000019747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]