SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019751 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019751
Domain Number 1 Region: 436-566
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000282
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 2 Region: 628-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000247
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 3 Region: 653-785
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000345
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 323-458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000424
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 5 Region: 781-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000801
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 813-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000703
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 7 Region: 298-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000119
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 853-911
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000199
Family VWC domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019751
Domain Number - Region: 593-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000605
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019751   Gene: ENSTNIG00000016644   Transcript: ENSTNIT00000019981
Sequence length 1225
Comment pep:novel chromosome:TETRAODON8:17:2320622:2343086:-1 gene:ENSTNIG00000016644 transcript:ENSTNIT00000019981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQQSGGMVSRRGSLVAALLLCLLAQVSEGSGQFELQILSMHNVNGELLSGVCCDGARSAG
DRKCARDECATFFKVCLKEYQSRVHAAGPCSYGMGSTPVLGGNTFSLKSSVRIDKSRITL
PFSFAWPRSYTLIVEAFDSNNETSGADSRLIEKAPHSGMINPSPQWQKLTHNGPVAQFEY
QIRVICDEHYYGFGCNKFCRPRDEFFGHYTCDYNGNKTCLEGWSGPDCNTAICRQGCSIE
HGSCKEPGECNCLYGWQGQYCDKCIPHPGCVHGTCVEPWQCLCDTNWGGHLCEKDLNYCG
THQPCLNGGTCINTGPDKYQCTCAEGYSGANCERAEHACLSGPCSNGGSCSETSQGYECQ
CAAGWSGPSCTIDIDDCAPNPCNHGGTCQDLVNGYKCHCPPQWMGKTCLIDANECDSKPC
VNANSCRNLIGGYFCECVPGWTGQNCDIDINDCRDQCQNGGTCKDLVNGYRCMCPAGFSG
EHCEKDVDECLSSPCLNGGRCQDEVNGFQCLCLAGFSGNLCQLDIDYCSPNPCLNGASCF
NLATDYYCACPEDYEGKNCSHLKDHCRTTTCKVIDSCTVAVASNSTPGGERYISSNVCGP
HGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICADGWEG
DHCQLNIDDCSTSPCYNGGTCRDLVTDFFCECKNGWKGKTCHSRESQCDEATCNNGGTCY
DEGDAFQCKCSPGWEGTTCNIAKNSSCLPNPCENGGTCVVAGESFTCVCKEGWEGPTCTQ
NTNDCSPHPCYNSGTCVDGENWYRCECAPGFAGPDCRININECQSSPCALGSTCVDEING
YRCLCPPDRTGSHCHEVMRKPCFVNGHITPDGVKWDEDCNTCHCANGKVVCTKMWCGPTS
CRVSANGRRECPSGQTCVPIRENQCFVKPCPGFGECSNYLPPPSKCHPGSCFQDNSCANI
TFTFNKETISEASLTVEDVCKQLRRLYVVKNFSLEHSTSINCDPSFSASNEIHVCISTED
HQLDRSPIKEITDRIIDLLSKGNVNNTILTAIAEVRVPKPDKPVSSSDYLVPLLSSIFIG
LWVLVLVFSLLWCMRRRRKQSNHNGASATGSEDNTTNNVREQLNQIKNPIEKHVGLTVAI
KDYENKNSIIAKIRTNHPEGDEDNKERHLQKGRFAKQPTYTLVERDEKTPISNPNSTSKN
PNWTNKQDNRDLETANSINRMDYIV
Download sequence
Identical sequences H3DGV7
ENSTNIP00000019751 ENSTNIP00000019751 99883.ENSTNIP00000019751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]