SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019767 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019767
Domain Number 1 Region: 411-637
Classification Level Classification E-value
Superfamily GFP-like 1.26e-85
Family Domain G2 of nidogen-1 0.00000016
Further Details:      
 
Domain Number 2 Region: 916-1163
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-44
Family YWTD domain 0.0000000112
Further Details:      
 
Domain Number 3 Region: 787-895
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.58e-24
Family Thyroglobulin type-1 domain 0.00041
Further Details:      
 
Domain Number 4 Region: 368-408,646-745
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 744-816,1173-1213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000104
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019767   Gene: ENSTNIG00000016660   Transcript: ENSTNIT00000019997
Sequence length 1220
Comment pep:novel chromosome:TETRAODON8:17:1995303:2008355:1 gene:ENSTNIG00000016660 transcript:ENSTNIT00000019997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLLLKTRIMGRQERGWLVCLSFLGFVASVESITRGELFPFGPSAGDQILAAGSDQTHRLE
LDSPVLFYDGTFDSIFVNTNGFVATAEPTGESTYLGKMPSRFGMIAALQGDLDTSDEVGR
VYFRQDSSPEVLGRAAEHMNRAFPEDPAVSPTRAVIVTWADVAPREPESRGDTLVRKRNT
FQLVIASTKNASFAIVLYANDGIQFTSTTVEGGVAILHAGFSKGIVQGFLFSSQGPYFRI
TTDEEESIRALAEETNSGMQGVWVYEIGTSPYFTNVAPGEVPYLPTEAPTPEIFEVDGGS
LGFDRGQQVEYPTFEPEGDQIQVHPVQYQPGQPGNPEVLVVEDADIDVDAFPSVSSLRSC
TCPVFSYNLGTCASGRNTCSQYADCKDYSSGFCCHCRPGFYGNGIQCTAEGKPQRTNGKI
HGSVYVGNSPSPVQLTGNDLHSYVVVNEGRSYVAISEIPDSLGPSLQPLAAIGSAIGWAF
ALEQPGFKNGFSIIGGEFTRQVEVTFQPGNEKLTIRQEFKGIDEHDHLVMSTTMDGRIPQ
VPYGATVKIEPYSEIYHYSSDLITSSSTRDYVVNLPDGSADALTYQWRQTITFRSCQHGD
AWRDVKPTQLLSVDGVLAMYDSNEVMRFTMTNKIGDVNGGEPEENPCFTGRHGCDTNAIC
RPEQGTQFTCQCAAGFNGDGHICYDVDECREEPQICGFHAVCNNHPGTFRCECEDGYQFG
SDGRTCTASALSRPVDACDEGTHTCDIQERARCTYTGGSSYSCSCLPGFSGDGRTCQDID
ECQAGPCHRDAECYNNEGSFTCQCAPGYYGDGFLCTPERTKTRCQSHRESLLSVTEYGPR
GPRPSGGHYIPRCDENGAYEPTQCHGSSGYCWCVDRNGQEIPGTRSEPGSSPMCEGGLRP
PVGPTPRPDVHPLPPGTHLLFTQSGRIEHVPLEGSAMKKDDAKPVLHLPEKVVIGVAYDC
VEKMVYWTEITSPSISKASMEGGDPVSVVRSDLGSPEGIAIDHLGRTVFWTDSVRDRIEV
ASLDGSQRRVIVDSDLVNPRAIVADPPSGNLFWTDWNRDAPKIETSYMDGSNRRVLVKDD
LGLPNGLTYDRHSFLLCWADAGTHAMECMDPARGDRRKVAEGVRYPFAITSLGNTVYYTD
WQREAVVAVDRHTGEETDQFQPQKRTKLYGLTTTYAQCPSGQNYCSVNNGGCTHLCLATP
LGRSCRCPNDAASVGCVERD
Download sequence
Identical sequences H3DGX3
ENSTNIP00000019767 ENSTNIP00000019767 99883.ENSTNIP00000019767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]