SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019835 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019835
Domain Number 1 Region: 104-255,348-494,527-638
Classification Level Classification E-value
Superfamily Ras GEF 7.06e-109
Family Ras GEF 0.00045
Further Details:      
 
Domain Number 2 Region: 763-857
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.84e-40
Family Ras-binding domain, RBD 0.00000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019835   Gene: ENSTNIG00000016725   Transcript: ENSTNIT00000020065
Sequence length 888
Comment pep:novel chromosome:TETRAODON8:12:10019761:10031034:-1 gene:ENSTNIG00000016725 transcript:ENSTNIT00000020065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGISSEARSVDPVQLVEMFESSWRVRNIWDGVKLEVVEDRSPVVLHSFTHLDPDLPLLES
STQEIGEEAEEDAVFTITLRKMQLHQSASKGQRWLGVETDSALSLYETCKVRTIKAGTLE
RLVEYMVSSFRGKDSTYVTIFLCTYRSFATTKQVLDLLLHRYAKLQNVPAATAHRVCQDD
CTELRKRSTVSSILGAWLDQYSEDFWSPPNYDCLHQLLSYLHRHFLGSDLERRARNLLAH
FLRRQQCEPDPDGMKAGQERANQTAKKPRLCGRICRKVNLIAKKRMGSAVTVLRWWEHIG
CPFATQEESGFEDELPAFSFLSFDPIMVRSSSPSWTPPFFLKVGCVSKRLIRSVSGSLSV
QDLFKKVVPYHCLGGIWSQRDKKGKEHLAPTIRATVAQFNSVTNCVITTCLSNPALKPNQ
RARLLERWIDVARECRILKNFSSLRAILSALQCNAIHRLKRTWEEVSRESFRTFRELSEI
FSDDNNYSLSRELLVKEGTSKFATLELNPKRAQRRHQQQRDLGVMQGTIPYLGTFLTDLV
MMDTAMKDYTEGGLINFEKRRKEFEVIAQIKLLQLASNNYSFTPDSHFREWFTGVEKLSE
AESYNLSCEIEPLSESASNTLRAKKNGGIMKRWSDRQLTEPSCSGSAGSHSKSFDHAHFR
PYQGGGGDSGDALSVTSVSSSGSDLEDVNASFLSDSPEGHERKFWECTSLSSLDTSGTGS
SSGSASGSSSASSSSVSCSTPLSASRSHKRSVSAVSNYSTLSLPLYNQQIDDCCIIRVSL
DVENGNMYKSILVTSQDKTPAVIRKAMIKHNLEREKTEEYELMQKISEDKELRIPDNANV
FYAMNSTANYDFVLKKRGLGRPARAKAVASSTLPRMKQKGLKIAKGIF
Download sequence
Identical sequences H3DH41
ENSTNIP00000019835 99883.ENSTNIP00000019835 ENSTNIP00000019835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]