SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019839 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019839
Domain Number 1 Region: 185-316
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-24
Family SH2 domain 0.00094
Further Details:      
 
Domain Number 2 Region: 556-724
Classification Level Classification E-value
Superfamily Ras GEF 2.09e-20
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019839   Gene: ENSTNIG00000016729   Transcript: ENSTNIT00000020069
Sequence length 846
Comment pep:novel chromosome:TETRAODON8:12:10051013:10068054:-1 gene:ENSTNIG00000016729 transcript:ENSTNIT00000020069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYNYGKREKRSFKGLKWFGSLTNLTNKSTTKAALGGGEGLTGAAPGGQPEDQVQPCLRSP
GYAHSSEMYTHVGTAPRRSSPLTPEAQHVSQADGCVRKPSNMAASGAKAASPQDLYVPMD
PIYEGAHTHKSAPTKSPRGVALKQEPDVLEPTAPEEKSPPFMFFSLTGSADSSGEYVKFS
KGKFWLEPLSENLKKQLEEELRLSSTNLKSHAWYHGPIPWEVSESLVVNHGDFLIRDSQS
NRGNFVLTSNWQQKTLHFLIRKAALQPGETYPRVQYSLEEEAFESLPALVHFYVGSRAPL
TQWSGAQIQRPVNRTMPLSYLETAFGAIIGSPSRHGDALCGQQNTSQTRPLLDCASWDLM
TKKSSYSRDKRLQREAPSLRMASILLDKLPKTFLVKPRSELSSDPPKRTTCFQISQLPKK
SVETLTGNDEVVRFTCQRKLVPSTLSPRQREDTDKKPLLHFLPKHTKRKTTPSPIIETLS
DPDSAKTKELKVPQSGNQTTSSTKTLALRAHGYVERLRVEDQPRTEDGDAYCLPVVEAAS
SFRPSVYVSALMKENKPLEVGILRRAKELLAEVDPRTAAKHITKADCTVARILDVTPEVQ
KMMGVGSGMELLTLPHGQRLRLDLLERFHTMATTLAVDVLGCTGTTEERAGLLHKMIQIA
AELKSTMGNMFGFAAVMRALELPQISRLEQAWTALRQRHTEGAILYEKTLRPFMKSLNEG
RESCSLSNTTFPHVLPLLFLLEKSAAASEGLEPWESVEAGVDVVMFHLGAARTFAQQGGT
YCSNAETKLKGFQERPEVTELFLTNFQMRLLWGSRGAEEKQALRYSKFDQVLTALSNKLE
PPVRPH
Download sequence
Identical sequences H3DH45
ENSTNIP00000019839 ENSTNIP00000019839 99883.ENSTNIP00000019839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]