SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019847 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019847
Domain Number 1 Region: 812-870
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000549
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 702-756
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000112
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 3 Region: 579-647
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 23-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000994
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 754-817
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000706
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019847
Domain Number - Region: 527-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000103
Family TSP-1 type 1 repeat 0.012
Further Details:      
 
Domain Number - Region: 649-699
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00106
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019847   Gene: ENSTNIG00000016737   Transcript: ENSTNIT00000020077
Sequence length 917
Comment pep:novel chromosome:TETRAODON8:12:10177524:10184072:-1 gene:ENSTNIG00000016737 transcript:ENSTNIT00000020077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVCTQEDGVASNSLEEELEVTTYWWGEWAKWTACTRTCGGGVMTQERHCLKQRSRKKVVA
GKDNMTCTGTAKKYHLCNTKECPATGRSFREEQCWSFNSQLYNGRSYQWKSLYPDDYVHI
SSNPCDVHCTTTDGQRQLMVKARDGTSCKYSSYRGVCVDGKCEPIGCDGVLFSSNTLDKC
GVCQGDGSSCSRVAGNFRRVAMTLGYSFITQIPEGAWDIQIIERKKSTDVLAVTDQAGNF
FFNGAYKLDSPQNFHAAGTVFKYRRPMDVYETGIEYVVAKGPTDQAINILVWNQNGRTPY
ITFEYTVLRESLPPVPPPPVYTGADSSAGEVSVEVVGLLAPNSSIYYQAAPEDSRGVEVQ
KGQETNEVYEESAAIDCDQDAPAAPKYSENNSSHTGSTAKPVPAGGSLDVRPDAPNLIWR
VLLGGRIGPDELLINISTNQLLTDGDAEVGPMETGLSGTETDGPLGLNETLEFTLGRKRN
DSGDGSFQNKTVQTGGRPSSRSNRTRFGNRGNQRFNQKNLKLSAADMYRWKLSSQEPCSM
TCSIGNMNSFVTCIRYDGVEVHDMYCDALTRPEPVHDFCIGRECQPRWEASSWSECSRTC
GEGFQFRQVRCWKMLSPGLDSSVYSELCTMADLERPIERRPCKSPACGPQWEVAEWTECP
AKCGRRAQVTRDVRCSDETRPCDPMTKPPNIKNCTGPPCERHWTMSEWGPCSGSCGQGKM
MRHVYCKTPEGRVVPDNQCPVENKPLAIHPCGGRDCAPTWLSQDWERCNTTCGRGVKRRV
VLCVGISGGKFQMFDEEACGGSLSKPEGETTCFERPCFKWYTTPWSECTKTCGVGVRMRD
VKCYQARELVRGCDPLTKPVSKQTCTLQPCPTEPPDESCQDRPSTNCLLALKVNLCSHWY
YSKACCHSCRAVRPPTS
Download sequence
Identical sequences H3DH53
99883.ENSTNIP00000019847 ENSTNIP00000019847 ENSTNIP00000019847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]