SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019910 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000019910
Domain Number - Region: 100-158
Classification Level Classification E-value
Superfamily Clc chloride channel 0.000458
Family Clc chloride channel 0.0095
Further Details:      
 
Domain Number - Region: 8-38
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0186
Family NlpC/P60 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019910   Gene: ENSTNIG00000016796   Transcript: ENSTNIT00000020140
Sequence length 167
Comment pep:novel chromosome:TETRAODON8:1:8120536:8121883:1 gene:ENSTNIG00000016796 transcript:ENSTNIT00000020140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVRYDKKPEVGDLIDINRGSYHHWAVYVGDGCVVHLAPPCEAPGGQSASVMSVLTDRA
LVKKEELWVVVGNDKWKINNILDDKYEPRPGHIIAKEACALVGQEWPYCVIRGNCEHFVT
ELRYGKAESRQVRQVLTAGVGAAVAVVAAAALAGLLFGGSRKENKNT
Download sequence
Identical sequences H3DHB6
99883.ENSTNIP00000019910 ENSTNIP00000019910 ENSTNIP00000019910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]