SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020196 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020196
Domain Number 1 Region: 14-98
Classification Level Classification E-value
Superfamily E set domains 6.72e-21
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020196   Gene: ENSTNIG00000017064   Transcript: ENSTNIT00000020427
Sequence length 167
Comment pep:novel chromosome:TETRAODON8:Un_random:107190788:107191674:1 gene:ENSTNIG00000017064 transcript:ENSTNIT00000020427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPLSPCPPPPAATPCIKAISPSEGWTTGGATVILIGENFFDGLQVVFGTMLVWSELITPH
AIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPG
DPERLPKVSHTQTTHTNTHTHTHTHTHTHTHTHTHKLSDCFVFWLTA
Download sequence
Identical sequences H3DI52
ENSTNIP00000020196 99883.ENSTNIP00000020196 ENSTNIP00000020196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]