SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020352 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020352
Domain Number 1 Region: 57-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-27
Family Laminin G-like module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020352
Domain Number - Region: 350-531
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0761
Family YVTN repeat 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020352   Gene: ENSTNIG00000017215   Transcript: ENSTNIT00000020583
Sequence length 675
Comment pep:novel chromosome:TETRAODON8:10:8711282:8716192:-1 gene:ENSTNIG00000017215 transcript:ENSTNIT00000020583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLILVQILLVGLRVTGTTTDTWRQCKDLNPVDLLSFVLEKDPSKLVPNVQVKQAMGVR
GVRFSGPHTSMSFASSQLLTNCELLPQNVSIVVTLKISSGAAKKNEYIFTLMEPNREKLI
LGLRLSQNRLHFFFKSSGGTVENCKFRSSPLDDNRWHTLVLAVNNQRVSLTVDCGAPLEI
FPTRHFPSGLSFQGSKFHIGSKGKWKGLFSGLLRQLVLLPGSDATHHICPSSTPQLAALS
VPPLLSDAAHPGSDDDEQVIYHTQEEKVSVGLQRSCTEQIKGQLWFNPLRKGLYLCDGTT
WIAVLEDHKRLDYLLEYQVLTTSSETHDIEVFQVPGVGLMAAMAHRSTFSGSAVYIWNHT
SFQLYQNISTYGALAWRHFIMGKKTFLVVSNSGGEPGKHYKQEKRMDFSVIYKWSRKRKQ
FVRVQTLQTYCARDWEAFKINRQTYLAVANHRKGDNNHTIDSVIYKWNRLTKSFEVHQLL
PTSGAYDWEYFTVGPYHFLVVANAFDGMTTSVDSVIYVWINGSFQVFQTIKTFCATDWEM
FQIGSRIFLAVANGHKLQASGPSQYAINSTIYELDMMGQMFVRFQDILTYSAVDWEFFSL
GENHFLIVANSFNGESYSLNSILYRWQGYEGFVPVHWLPTIGCSDWEYFNYQGEAYLIYS
SAKAPLSKVFKLKNP
Download sequence
Identical sequences H3DIK8
ENSTNIP00000020352 ENSTNIP00000020352 99883.ENSTNIP00000020352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]