SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020441 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020441
Domain Number 1 Region: 151-269
Classification Level Classification E-value
Superfamily C-type lectin-like 1.51e-30
Family C-type lectin domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020441   Gene: ENSTNIG00000017303   Transcript: ENSTNIT00000020673
Sequence length 272
Comment pep:novel chromosome:TETRAODON8:10:6927174:6928762:-1 gene:ENSTNIG00000017303 transcript:ENSTNIT00000020673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSENMFLFLMLVSVLSSVTRHAVCAQQLTEESCTVQILVPGLKGDPGEKGLKGAPGRPG
RLGPTGETGQPGPKGQKGIMGRYGKVGPSGIKGLKGDMGDPGPRGPNGDPGVPCECTPMR
KVIGKMDIDVAQLFSELKFIKNAVAGIKETDTKVYLLVKEEKRYSDAELYCQARGGHLAM
PKDEGANAALAAYITGAGLNRVYIGIHDLTQEGVFTYVDLSPMTAFSKWKRGEPNHAHED
EDCAEMLASGEWTDAVCQSTMYFVCEFNKESV
Download sequence
Identical sequences H3DIU7
99883.ENSTNIP00000020441 ENSTNIP00000020441 ENSTNIP00000020441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]