SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020582 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020582
Domain Number 1 Region: 959-1172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-105
Family Thrombospondin C-terminal domain 0.00000000336
Further Details:      
 
Domain Number 2 Region: 29-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-38
Family Laminin G-like module 0.000000641
Further Details:      
 
Domain Number 3 Region: 836-957
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.48e-36
Family TSP type-3 repeat 0.000000326
Further Details:      
 
Domain Number 4 Region: 492-550
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.36e-16
Family TSP-1 type 1 repeat 0.0000507
Further Details:      
 
Domain Number 5 Region: 439-488
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000288
Family TSP-1 type 1 repeat 0.0000859
Further Details:      
 
Domain Number 6 Region: 319-377
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000146
Family VWC domain 0.0042
Further Details:      
 
Domain Number 7 Region: 696-779
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000667
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 768-838
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000353
Family TSP type-3 repeat 0.00036
Further Details:      
 
Domain Number 9 Region: 382-432
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 10 Region: 551-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020582   Gene: ENSTNIG00000017441   Transcript: ENSTNIT00000020814
Sequence length 1174
Comment pep:novel chromosome:TETRAODON8:10:4706014:4712083:1 gene:ENSTNIG00000017441 transcript:ENSTNIT00000020814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMMLCGIFLLLMLWGCEGARLAGSPDDNSVYDLFDLARVSKRQNGVTLVKGADPYSPAYK
VLNADLIPSVPDSSFRDILDSILAERGFLLIINLKQFRKSRGSILTIEKNDGSGSIFEIV
SNGRANTLEVLYSTANHQQVVTIEDTDLATGHWKNITLFVQDDRVKLYVGCEEVNEAEMD
FPIHKVLTQELADVATLRIAKGAVRDKFTGVLQNVRFVFGTSLDEILRNKGCQNGAVLTD
VMTLENPVNGSSPAVQTDHPGHKAKDVQPGQVCGLSCEDIAGIFKELRGLGVVVRKLSID
LRKVSEESMLLKNETKQSGICIHNGIVYQDKNEWTVDSCTECTCQNSATVCRKISCPLVP
CANATVPDGECCPRCGSSMVSAQGGWSPWSAWTQCSVTCGRGVQQRGRSCDRINSNCEGT
SVQTRDCYPQECDKRFKQDGAWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGMDCQG
EGRQTEICRKSPCPIDGGWGPWSPWDTCTLTCGKGIQTRKRLCSDPAPRFGGKDCVGEAK
MSQVCNKQDCPIDGCLSNPCFPGAMCTSFPDGSFRCGKCPLGYTGDGLTCKDIDECKEVP
DACYVHNGVHLCENTEPGYNCLPCPARFSGPQPFGRGVEQATAKKQVCEPRNPCRDGSHD
CHKNANCIYLGVYSESMFRCECKPGYAGNGHICGEDSDLDGWPNHNLVCVENATYHCSKD
NCPSLPNSGQEDHDKDGLGDECDTDDDNDRIPDDRDNCPRLYNPAQYDADRDDVGDLCDN
CVFEANTDQTDTDSNGEGDACAVDIDGDGILNEDDNCPYVYNVDQRDTDRDGVGDHCDNC
PLEHNPDQIDSDSDRVGDKCDNNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDH
DDDNDGIPDDKDNCRLAFNPDQTDSDGDGRGDICKDDFDQDSVLDIYDVCPENFAISETD
FRRFQMVPLDPTGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYDEFSAVDFSGTFFINT
DRDDDYAGFVFGYQSSSRFYTVMWKQITQTYWSTTPTRAQGYSGLSIKVVNSTTGPGEHL
RNALWHTGDTAGQVRTLWHDPKKIGWKDFTAYRWHLTHRPKTGLIRVVMYEGKRIMADSG
NIYDKTYAGGRLGLYVFSQEMVYFSDLKYECRGK
Download sequence
Identical sequences H3DJ86
99883.ENSTNIP00000020582 ENSTNIP00000020582 ENSTNIP00000020582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]