SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020653 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020653
Domain Number 1 Region: 472-560
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000367
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 4-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000831
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 382-459
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000596
Family C1 set domains (antibody constant domain-like) 0.045
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020653
Domain Number - Region: 288-368
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000663
Family I set domains 0.047
Further Details:      
 
Domain Number - Region: 195-279
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00783
Family C1 set domains (antibody constant domain-like) 0.036
Further Details:      
 
Domain Number - Region: 105-196
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0957
Family C2 set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020653   Gene: ENSTNIG00000017509   Transcript: ENSTNIT00000020886
Sequence length 588
Comment pep:novel chromosome:TETRAODON8:Un_random:26826276:26828993:1 gene:ENSTNIG00000017509 transcript:ENSTNIT00000020886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTMGKISLWVEPSAEVPWDTDVTLRCRVPVSSLEQAALNRQYTIYRGSSAIVSKTSNTSD
DFLHLLPRVRFSNSGKYQCAVKIEETLKYSNTKKLTVTGLSTPVLSVDKVQVNEGEEITA
KCSAPGETGSIFFSFYSNATELVEKQEQSDRVEVKVHLGSAGLHQIHCRYTVMLSPDTFG
SQDSNISNSVNVSVTELPIEPVLVVAPEQQIFEGDTLSIDCSISSLQWSQGNVSVFLSQA
NHLLAYGTNRVQLSLLVRAGDTADLECTMEVGRVTKAVSKRVPVGELFSAPRLTLAPSEV
FQEEPMTLTCRSERFAPERLRREDLTYSLVSVGHLLQPGANGVFVGKSLSHDFNYTCEAR
AKGLSKSSPVLTVRPKVAASVPRIWVKGRAILGRPVRILCQSDSGSPPINYTLLRGWEPV
DTVSVQLPSQQAEFTVGVSSSAELSRLTCEARNSPRKAPRSPGLDALVVEPLTEATLTVI
PDPADISEGDHLILICGVNGTPPITFKWFRSGQETPLHAITVDKNTSDFQIQHLSQGHSD
SYHCQALNYANLILSPPLHIQGAVRLALWKKALIGGVCLLAALVLALV
Download sequence
Identical sequences H3DJF7
ENSTNIP00000020653 99883.ENSTNIP00000020653 ENSTNIP00000020653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]