SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020724 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020724
Domain Number 1 Region: 55-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000114
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 2 Region: 163-218
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000118
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 107-163
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000126
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 4 Region: 2-46
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000641
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 5 Region: 586-843
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000183
Family Rhodopsin-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020724
Domain Number - Region: 230-275
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00366
Family Hormone receptor domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020724   Gene: ENSTNIG00000017578   Transcript: ENSTNIT00000020957
Sequence length 1206
Comment pep:novel chromosome:TETRAODON8:21_random:2530929:2543350:-1 gene:ENSTNIG00000017578 transcript:ENSTNIT00000020957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEWSPWSSCSVSCGEGWQSRTRLCATTTSSFTTQCVGPLRENRSCNNTAVCTGVVDGAWD
EWTPWSLCSSTCGRGYRDRTRTCKMPKNGGEPCRGPSRQTKFCNIAVCPVDGSWNEWSTW
SACSASCSNGTKQRTRECNGPSYGGSECHGSWKETVNCFLKDCPVDGRWHAWSSWGSCSK
TCGGGVQQRQRVCEGPFFGGEPCPGEKGEQKRCNERRCPEPHEICAEQNTGEAVWRKTPA
GDEAAVACPSDASGLILRRCTLDAVGLASWENPTYVKCVSKNYENIQLLARDYISKSQTG
QSMDGFAEVISRLRFSSDEGAKYSGDLLAIMEILKNTTELYKGNGLKLSNADVENYVQTI
SNLLREEHHDKWEEAQLGNNIKEFLQLVEEFVNMIGMQMSGFQDIYEVTENLVLSIHKRP
TTTSSNFTFPLKGWRGMLDWIRTSEEKISVSRDALSIDQPGKPDGSDAFVTGIILYRNLG
SILPFQSNNSLLNSKVVSVIVKPTPTLLSSPVEIEFPHLHNGTVNETCISWDESESSSLL
GSWSARSCRAVPVHPFRTKCVCDSVSTFAILARVNLDSMMDKALLPSVTLIVGCGVSSLT
LLLLIIIYVSVWKYIRSERSVILINFCLSIICSNALILVGQTQARNKVVCALVAALLHFF
FLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVVAVSVGFTKANGYGTVN
YCWLSLEGGLLYSFVGPAAAVVLVNMVIGILVFNKLVSKDGITDVKLKERAGASLWSSCV
VLPLLALTWMSAVLAITDRRSALFQILFAIFDSLEGFIIVMVHCILRREVQEAVKCRVVD
RKDDGNGDSGSSLHNGQTHMQSDSEKDGDSGRQALRAWKGTYHLNTFFHLEGMKSSSEEK
MPSSHLPLPMGSNFHTLPSKPSKSHMQAVPEYSSHTLTLRREKSRLVGGIDPSCGKPVYV
CEGELFKQLDADLAGAQGEGSMSEGSGYVLMPNTTSTLRSKPKDDPTKYNISMDQLPQAR
LMHLGGPFAEPQAAFGIQSIPPDQVSISFSERDSPIQNIHNMSSESHITHSSLENTFESM
NSMMSKSETISTLSMSSLERQKSRYAELDFEKIMHTKKRHQNMLQDLNRKLHHAEKDRES
PASDSKDKQQGPLDRPWEGVRGIPQSPPAWVRKDLEPLAASPREWEKASTTIPLVGQDII
DLQTEV
Download sequence
Identical sequences H3DJM8
ENSTNIP00000020724 99883.ENSTNIP00000020724 ENSTNIP00000020724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]