SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020759 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020759
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily Lipocalins 7.23e-39
Family Fatty acid binding protein-like 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020759   Gene: ENSTNIG00000017612   Transcript: ENSTNIT00000020992
Sequence length 127
Comment pep:novel chromosome:TETRAODON8:Un_random:20198312:20199077:-1 gene:ENSTNIG00000017612 transcript:ENSTNIT00000020992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFAGRWLTETQEGYDDFCKLLGIPADIIEKGRDYKMITEVTQDGDTFSWTQVYPTDAKV
TNTFTVGKESDMETIGGKKFKATVFMEGGKLSVTFPNYHHTSEISGGKLIETSKAGSVVL
KRTSKKL
Download sequence
Identical sequences Q4RL26
ENSTNIP00000020759 ENSTNIP00000020759 99883.ENSTNIP00000020759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]