SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020781 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020781
Domain Number 1 Region: 1319-1467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-22
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 2 Region: 1479-1644
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.73e-20
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 3 Region: 1115-1230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000385
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 4 Region: 770-920
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000336
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 5 Region: 939-1091
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000712
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 6 Region: 83-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family Laminin-type module 0.063
Further Details:      
 
Domain Number 7 Region: 23-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000711
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020781
Domain Number - Region: 343-429
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 0.0435
Family Acetyl-CoA synthetase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020781   Gene: ENSTNIG00000017633   Transcript: ENSTNIT00000021014
Sequence length 1646
Comment pep:novel chromosome:TETRAODON8:1:12112604:12121634:-1 gene:ENSTNIG00000017633 transcript:ENSTNIT00000021014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQKCGPGFYRERAGPHKGQCVPCRCSGFSSECEAETGKCTNCQSHTSGERCERCGEGYYR
GAVNQACQACPCPSTRNNFAVACLDIGSGVMECLCKRGYIGANCGRCAFGYYGNPAQDGG
SCKPCSCKYNNLSLCDPLTGECISSGDSSPTSGCRGESCVATLLVEAEKWDGGLGSWEQR
LQNISADLDSVSWLNHLAANVSATEVELRQASGAALDLVNVSVKVKETNVKAEDLLSGAE
AIMTAAQGNGYVSDRVNGVHGTMQQPSLKASYNANRSLSVILLSQQLTKVKQGPPPTPAE
QRKMVEAAHDMVQTARERGCVSQRDEAVREREEAQTFQCLCVVTVWNSTKNMAAADLQML
LDQSADALLTSERSLRRMAEPLSEDAHNRLRGLNLKSLHVLGHVEMCVCVCVHTDNRVTL
MFHPLWQPLYSQLSREAEALLRASNSTKDLLDEVSRYSFNTGQGSAPALAVGPGKSLRNI
TEEADRAANQSSGDYYSLRRFAPALAVGPGKSLRNMTEEADRAANQSSEIAGQILEAVRA
TDPSNTAGRTKEESWHLWTDVSETERDISAVSDTVDTWKDRISKQKDEQESLTRNIWTWN
NDLKAIRGDHTAALIESAKTAASAANSTIAMATTRLSNISREVEAISSTSGNPDKLLSDA
EDMLWNLTQTFPLLEDKVRHVEELSGMAPPAGANVTASIRNIKEVIEDTRNLISSKLSFA
TIFNGSGYVELQPPRNLEDIRVFTVIDLLLNRHLSGTRSRRKKRQDKHKDGNAFVFYMGN
KNTSGDYIGMAIRHKVLVCVYKLGGVVHEVETSQVTKTSTNSSNMDRVIFNRVYQDAEVH
ITHNFTSQQPVQLPPKRNLPNTTAGVLELEPQSFVFYVGGYPQDFSPPAELDYPKFRGAM
KVTYINDNPVSLFNYMSAVNKETRLPTVRMPRSEVSDYYDGTGYRMAFIKDPDNLKRRFF
KFRTQSRETNALLFVIGNEDTFFCLIVEGGFLVLRGRQAGQDLRVQSAAKVSLFVVVIDD
AFTVHYGPDRISVQHIRTSYVSYYIGGLPASLRRSLKVIAPPLRGCVRHVTADTESVKYE
TTLGVAAGCPVSLLGVRAATVRAPLSADSLFVRDHQPFQVSMGFRSTHTYGTLIRSGSQA
SVHHFQLSLADGYAVFHSDNYTLRSDRRYSDGRWHYLSASRSSAGLELSIDNAKVTQNQS
PQIRPVGRNRGKFTGCVSNLYTRRLDRSLTPADLSWLSQEGRDVIPGVCSLPGWKRPQED
PSVSEPSCFLWDSYPAGAPGCVKIRPQQAAGVNPSRITSSLRTAGSVTPSHSHFHGTAVF
LPCPRPHFALDIKTTSTKGLILHVPGAGTVPLLALYIASGKIKMSLGQDRIIFHKQRSND
GNWHRVEFSVEESTFHLLVDGVPVTDGHLANDEGSSLGLHSPVYLGGDPGANTKGHNVPK
NSIIGCVRNFKLNKKVLREPEASHNTPPCFNTLTEKGTYFGGGYIVSDKTLHAGSQFELV
FELRPHRLSGLLLQAKNNKTSLNVFLNETEVVVEMKDGAREVRVSVTPPRSLCDGEFHTV
TVSQQQGTVGVSVDSVSEHKDAPPASTALDTLHIGGKQAPGHLTLIHINTLFSLIGCLRN
VTLDGSPVVFQAESRVGHVISRCPAD
Download sequence
Identical sequences H3DJT5
99883.ENSTNIP00000020781 ENSTNIP00000020781 ENSTNIP00000020781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]