SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020869 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020869
Domain Number 1 Region: 206-449
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000000000126
Family Soluble quinoprotein glucose dehydrogenase 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020869
Domain Number - Region: 633-663
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000266
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020869   Gene: ENSTNIG00000017719   Transcript: ENSTNIT00000021102
Sequence length 696
Comment pep:novel chromosome:TETRAODON8:18:7756730:7777491:1 gene:ENSTNIG00000017719 transcript:ENSTNIT00000021102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKAMKNLQFVLVLAIAINAWECGDAKFGERGEMSPRRRRCSDGSVPQRLKRRERKALLDS
SSGEVCHRLYPRVSCCPTRKIPSQPLRLGIFSTNNTECGRLLDEIKCARCSPNGQVLFHS
PDTDKMPHREPDLPRLCQDFCREFYYTCRGHIPELFQADVDEFCQYYGRRDGTLCFPDFQ
RKRRDKISNYLEDEKPEDISRKQKHNCYCAQEVLSGLRQPVAVVHCGDGSQRLFVLEREG
IVRILSHNLELIKEPFLDIHKLVQNGLKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQER
WAIGPHDHILRVVEYTVSRKNPNQVDTRTVRVLMEVAELHRKHLGGQLLFSPDGLLHIIL
GDGMITLDDMEEMDGLSDFTGSVLRVDVDTDCCTSPYSIPQNNPYFNSTNQPPEIFAHGL
HDPGRCAVDRLRAENGSFLILCTDASGKNSTAGRILEIAKGKDYENEPSVYDLQSSGGAS
PLGGFIYRGCQSRRLYGSYVFGDKNGNLRTLQKSTLSTSASSEQWQEKSLCLGLTGFCSS
TLVGHILGFGEDEFGEVYILASSKSMVQSNSGKLYKLVDPKRPYAPKECQHQVEPPELLM
TACSRHCKNGHCTPIGKCCCSPGWEGPFCRIAKCEPACRNGGVCMEPNKCLCKSGYSGAQ
CEKSEGGMPNDQEKDGILDHFIDMTSYLLDLTSYIV
Download sequence
Identical sequences H3DK23
ENSTNIP00000020869 99883.ENSTNIP00000020869 ENSTNIP00000020869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]