SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020967 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020967
Domain Number 1 Region: 518-660
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.59e-17
Family Galacturonase 0.081
Further Details:      
 
Domain Number 2 Region: 119-222,409-557
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.49e-16
Family Pectate lyase-like 0.06
Further Details:      
 
Domain Number 3 Region: 5-74
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000458
Family F-box domain 0.0034
Further Details:      
 
Domain Number 4 Region: 713-837
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000314
Family Pectate lyase-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020967   Gene: ENSTNIG00000017811   Transcript: ENSTNIT00000021200
Sequence length 944
Comment pep:novel chromosome:TETRAODON8:18:570248:574860:-1 gene:ENSTNIG00000017811 transcript:ENSTNIT00000021200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVGNLPVELWRIILAYLPLPDLGRCCQVCCAWRELILSLDNTRWRQLCLGCPESRHPNW
PSQPHLEPPSWREALKQHAIATRTWTQNGPELQSSACLLFLRRRKDRKVWHVGPGCELET
LRSALVVAGPYDRVVLHPGVYEEQAEIVMKVPVELVGLGRLGEVALLVCVEQQCPTARLC
NLVFMPSWFSTVVYKTSWGHVQFDNCNFEGAQLQVRGPGTCQARFCSFSQGSSVHLLGVV
LSLLDSCDFSGSDAASVTLEGPPVSEKNWACKHLTALTRTFSSNRRSGKSNSPPVVKNER
LNADGGLHETGVGAVGRGTVIEDCWSEGDGSDREEENPDGGESGKAKTRLNQHYKIPCDN
HGLSHLLKRRKDGSLPAGSSPDPTSAAPELLTLQQELDRDPEAQMLAASTLGCVVRRCLF
RDGKGGVHLSNYGQARLEGNVFRHLNYAVRCIQNSTIVMLRNEVRECRASGVFLRLSAHG
LIAENDIHANGEAGLDIRKGANPIVVKCNKIHSGLRSGVVVLGNGKGSVRSNQIYNNKEA
GVYILFSGNPVVSGNHIFRGQAAGIAVNENGRGVITDNLIRENQWGGIDIRRGGDPVLKN
NFICYGYSDGVVVGERGRGLIEGNHVYCNKGCGVWVMSSSLPQLLGNYITHNCMYGLAVF
CRKDSENVESRGRDGQENLNEEGELFAWESDLDSEDERHSARRSISVALVESNCLNFNGA
VGLYVKSSEPLNVFANLINSNRGTGVTVLQSSQLTRLGTNCILNNGCGGVTVEKDCRAEL
RGNGIYKNGSHGVSFSGNGQIVENDVVGNRGCGIQISSGTDIKVLRNRVQPAQGCGIAVL
GPVRAFVQDNLLFQGHPGTKKTLLHMDPGNDGCVLRNNSILLHSSSFSAPSWVLENPPPR
PLVSSPCGLSLSQCPSGLGISMTTRISATVENGCHSGSMFCSIL
Download sequence
Identical sequences H3DKC1
ENSTNIP00000020967 99883.ENSTNIP00000020967 ENSTNIP00000020967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]