SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020984 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020984
Domain Number 1 Region: 31-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000781
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 2 Region: 76-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000242
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020984
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020984   Gene: ENSTNIG00000017827   Transcript: ENSTNIT00000021217
Sequence length 116
Comment pep:novel chromosome:TETRAODON8:2:21332936:21333624:-1 gene:ENSTNIG00000017827 transcript:ENSTNIT00000021217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCKPAFDGPRCEQCKSGFHSYPNSAFLFPVCSCDPHTSLDVSCTPSGQCRCQPNYSGASC
DQCAPGYYGYPSCAPCGCSAEGSHYSHCDRLSGQCVCRPGVVGRRCDACTHGLYGI
Download sequence
Identical sequences H3DKD8
99883.ENSTNIP00000020984 ENSTNIP00000020984 ENSTNIP00000020984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]