SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021001 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021001
Domain Number 1 Region: 7-212
Classification Level Classification E-value
Superfamily vWA-like 1.32e-50
Family Integrin A (or I) domain 0.00047
Further Details:      
 
Domain Number 2 Region: 834-1008
Classification Level Classification E-value
Superfamily vWA-like 1.67e-47
Family Integrin A (or I) domain 0.00044
Further Details:      
 
Domain Number 3 Region: 1031-1205
Classification Level Classification E-value
Superfamily vWA-like 2.08e-46
Family Integrin A (or I) domain 0.00052
Further Details:      
 
Domain Number 4 Region: 1235-1409
Classification Level Classification E-value
Superfamily vWA-like 2.08e-46
Family Integrin A (or I) domain 0.00052
Further Details:      
 
Domain Number 5 Region: 1433-1606
Classification Level Classification E-value
Superfamily vWA-like 2.67e-46
Family Integrin A (or I) domain 0.00052
Further Details:      
 
Domain Number 6 Region: 1643-1817
Classification Level Classification E-value
Superfamily vWA-like 8.9e-45
Family Integrin A (or I) domain 0.00079
Further Details:      
 
Domain Number 7 Region: 625-814
Classification Level Classification E-value
Superfamily vWA-like 2.92e-44
Family Integrin A (or I) domain 0.00051
Further Details:      
 
Domain Number 8 Region: 238-421
Classification Level Classification E-value
Superfamily vWA-like 2.23e-37
Family Integrin A (or I) domain 0.0021
Further Details:      
 
Domain Number 9 Region: 439-607
Classification Level Classification E-value
Superfamily vWA-like 6.68e-35
Family Integrin A (or I) domain 0.0019
Further Details:      
 
Domain Number 10 Region: 2593-2789
Classification Level Classification E-value
Superfamily vWA-like 8.6e-25
Family Integrin A (or I) domain 0.0045
Further Details:      
 
Domain Number 11 Region: 2333-2517
Classification Level Classification E-value
Superfamily vWA-like 5.56e-23
Family Integrin A (or I) domain 0.027
Further Details:      
 
Domain Number 12 Region: 3005-3059
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00071
Further Details:      
 
Domain Number 13 Region: 1839-2034
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000274
Family Integrin A (or I) domain 0.013
Further Details:      
 
Domain Number 14 Region: 2887-2980
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000099
Family Fibronectin type III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021001   Gene: ENSTNIG00000017842   Transcript: ENSTNIT00000021234
Sequence length 3073
Comment pep:novel chromosome:TETRAODON8:2:20907773:20956645:1 gene:ENSTNIG00000017842 transcript:ENSTNIT00000021234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMGHQLLPLCALLGILVSGFIYNLEAQEDCAQGLAADIYILVDSSWSIGEENFKHVRQFL
FSLTQALHHAGGDGFKFALVQYNNKAHTEFQLNSYATMAGVLAHIKSIPYRGGGTRTGLG
LDYLTRVHLNTGSGSRAVEGAVQVVVVLTDGRSQDDVAMPAQVLRLAGVELFAVGVQDAV
DSELREMASQPYDTHVFSVDSFLALRDIIQDLVVHNKSLHEKAELSGDSKQIQSIKAPDS
ADLVLLIDGSQNVGETNFPFVRDLVLKIVEALDVRSNAVRVALALYTSDLQTKFYLNSYD
SKAAVLDAVKGLTYPGGDESNLGAALEDVAMNLLNERAGGRAEDGVPQMLVVITAGSSDD
DTAAGDRALKGASVVTFGLGIGDTAAADLEAVATDKSFILSAPDFRTAAGIVDQLLPYVL
DVIRHNIIIQTEFREVPTVAKKDIIFLIDSTMGSQSINSMREFIKKVAYTLPIGPDEVQI
GVALFSNVPRVEFELNSHSTRESLADALGRIKPRSGPIINTGAALNFVRTNMFQAGKGSR
IEARVPQFLVVLTNKKSNDSVTQPALELLRKGILTIAVGSRAAGEEDLQSIAFAPTAAYV
LRDLRVLSRPAAQQPNEIINVLTTMTGTVQTHRVVRDIVFLVDGSDYVGSSNFAYVRDFL
INVVNQMDVHPDRVQFGLMQFSERPQIEFYLNTFDNRQDIVTRISQLRLTGGSVLNTAAA
MQYALQNMFTSSAGSRKQKNIPQLLVLVTGGPAQDNIKAMANNLAEAGIVTFTVSSGQAD
VETLKSVAFNPEIAYHDSRFSNIPAKAEEIMPMLIRVVGSIEAAGHTFDTSKKDIVFLLD
GSDGTRNGFPAMRDFVERVVEKLSVGPNKDRVSVVQYSRDAAVHFYLNTYTTKREILDAL
RGLRHKGGRALNTGEALQYLRNNVFTASAGSRRTEGVPQVLILLTGGRSSDSVDSPASDL
KQLGVLIFAIGSRGSDNREIQRISHSPTSALVVPEFTDLPSVQQQLLSSVRDVVDVGPEA
PTPAVDTSKKDIVFLLDGSDGTRNGFPAMRDFVERVVEKLSVGPNKDRVSVVQYSRDAEV
HFNLNTYSTREDIIDSVRGLRHRGGAPVRTGAALQYVRDNVFTNSSGSRRLQGVPQMLIL
LNGGRSYDSVDTPASSLKQQGVFVIGIGTRNSDRTELQKISFEPSYTLAVTEFTDLPSIQ
EQLSSVMSTVLLKDTAMPPTVTEVPTPAVDTSKKDIVFLLDGSDGTRNGFPAMRDFVERV
VEKLSVGPNKDRVSVVQYSRDAEVHFNLNTYSTREDIIDSVRGLRHRGGAPVRTGAALQY
VRDNVFTNSSGSRRLQGVPQMLILLNGGRSYDSVDTPASSLKQQGVFVIGIGTRNSDRTE
LQKISFEPSYTLAVTEFTDLPSIQEQLSSVMSTVLLKDTAMPPTVTVDTSKKDIVFLLDG
SDGTRNGFPAMRDFVERVVEKLSVGPNKDRVSVVQYSRDAEVHFNLNTYSTREDIIDSVR
GLRHRGGAPVRTGAALQYVRDNVFTNSSGSRRLQGVPQMLILLNGGRSYDSVDTPASSLK
QQGVFVIGIGTRNSDRTELQKISFEPSYTLAVTEFTDLPSIQEQLSSNSFTKPEAPTPAV
RDVVDVGPEAPTPAVERQPRGKDVVFLLDGSDGTRSGFPAMRDFVQRVVETLRVDDKKDR
VSVVQYSRDAAVHFYLNTYTTKREILDALRGLRHKGGRALNTGEALQYLRNNVFTASAGS
RRTERVPQLLILLTGGRSSDSVDSPASDLKQLGVLIFAIGSRGSDNREIQRISHSPTSAL
VVPEFTDLPSVQQQLLSSVRDVVDVGPEAPTPAVDTSKKDIVFLLDGSDGTRNGFPAMRD
FVERVVEKLTEMQRCISTSTHTPRERISLIRPTSALVVPEFTDLPSVQQQLLSSVRDVVD
VGPEAPTPAEFFHYSHKIIAKCVQSKVIVHLTDGLDAPFVEMKNRVEELQQSGVSSFILV
GLERVPKFEEALQLEFGRGFRYTRPLRLNVMDLDYELLEELDNIAERQCCRVPCKCIGSR
GDRGSVGITGTKGNPGLEGSQGHPGDEGTSGERGLPGVNGTQGFQGCPGQRGVKGGRGYS
GETGEYGDIGLDGINGEEVSSFYITTHAREHSLKNREVLRKRTVSGKGKGGVSGPPGDRG
NPGRRNLFLLLHHQGPDGRRGSPGLPGNPGNPGVAGSAGEPGSGGARGAPGPIGTPGNKG
EDGNPGPRGPGGNPGAAGDKGRRGPLGRKGEPGDPGPKGVVGPLGPRGEPGEDGRDGYGG
LGVAGRKGDDGFPGYPGQKGEAGDPGPKGIPGPRGNLGQRGVAGNPGPPGQKGEVGYPGP
YGEKGPRGPGVVQCDLVKKIRDNCPCCFGKQECPLYPTELVFALDTAQSTSRQNFINMRD
TVLRLIRDITISESNCPRGARVALTLYNDEVTTEIRFADALKKQALVQHIQGLQTLQTRK
ERRLDNAINFVAHNTFKRVRSGFLMRKVAIFFIGGPTGQVQMLTNAALRLHDAGISTLFL
VTREDRALSRALQVNNTALGQVIVLPSPGSAQYESVIQKVMSCHICFDTCSPDQTCDYVP
PTAGRDRRSSATDVDIDMAFLVDSSESTYPTAFTEIKRYIAHIVEQLQVSSHPTSSLHHA
RVAVIQQAPYEFIHNKSSSPIHVDIGLTQHHSSEEIVKFLLDKTPQLEGGRALAAALEAT
MEHVFEKAPLQRDRKVLVLFVTGSVEKDAAQLMRVATEAKCRGYFLVIFGVGEKLSAADV
HVLSHMASEPSDVFFKRLNSLSQFYERRLQTFGQLMPKYISIENAFFMSPEISKNCKWFQ
SDQPYKNPFTSPQQREDHIFQLQFFYRTQEKHHENHQSVVTKKHEYINLLIQAVKPFFDH
PPTDEYQLHIANVTSSSLRLHWSNPEPKLFVYFEVVLTHLRDHALILKTNVSGTELMVND
LDSAQTYHVVVTARTEDGQIVSTLKGTMTTKAAEPRPVHKPSHRGGGSASTKRRSRPAAA
LSTAVNICQLPKEEGTCAKFVLNWFYDSATGSCTRFWYGGCGGNANRFETHEQCLKTCGK
RGALLGFLGFSPF
Download sequence
Identical sequences H3DKF5
ENSTNIP00000021001 99883.ENSTNIP00000021001 ENSTNIP00000021001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]