SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021117 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021117
Domain Number 1 Region: 57-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 177-301
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-20
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 3 Region: 300-336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021117   Gene: ENSTNIG00000017955   Transcript: ENSTNIT00000021350
Sequence length 465
Comment pep:novel chromosome:TETRAODON8:13:4401675:4405057:1 gene:ENSTNIG00000017955 transcript:ENSTNIT00000021350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LESTKICSLLTVWTFLLFIQEGFALAQKAKDEGAGPKVLKAPLRPLHCGNWVRNADGGSF
SSPNYPNTYPPNKECLYVLEALPRQRIELLFDQSFYIEASFECRFDHIEVRDGPFSFSPL
INRFCGAASPGLVVSSGRFMWIRFYSDDELEGIGFQVRYSFTADPEFHLHIGGLLNPIPD
CQFELSGADGLIRSSQVEEENKVKADQAVDCIWTIRAPLNHRIYLRFLEYQMENSNECKK
NFVAVYDGSNAIEDLKAKFCSTVANDIMLDTSVGVVRMWADETSRLSRFRMLFTSFADPP
CSGGAFFCHSNMCINTSLVCNGIQNCVFPWDESSCKEKRSKGLFHHITKTHGTVICVSTG
VVLLLLILSILVQVKQPRKKVLIRKNNLFHRGDFQEVFDPPHYELFTLRDKEMSADLGEL
SEELQSLQAIRRSSSGSRCIHEHHCGSQASVNSVKASKENLTSLE
Download sequence
Identical sequences H3DKS0
ENSTNIP00000021117 99883.ENSTNIP00000021117 ENSTNIP00000021117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]