SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021286 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021286
Domain Number 1 Region: 596-810
Classification Level Classification E-value
Superfamily GFP-like 1.26e-60
Family Domain G2 of nidogen-1 0.0005
Further Details:      
 
Domain Number 2 Region: 86-172
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-24
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 156-253
Classification Level Classification E-value
Superfamily Immunoglobulin 6.01e-24
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 308-366
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.11e-16
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 5 Region: 2-77
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 6 Region: 902-1040
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 365-423
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000785
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 8 Region: 1008-1135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000204
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 423-480
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000222
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 10 Region: 483-533
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000484
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 11 Region: 253-309
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000017
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 537-594
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000249
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 13 Region: 816-921
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021286   Gene: ENSTNIG00000018120   Transcript: ENSTNIT00000021521
Sequence length 1243
Comment pep:novel chromosome:TETRAODON8:1:20041047:20048387:-1 gene:ENSTNIG00000018120 transcript:ENSTNIT00000021521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERLLLACGVNGIPTPHITWVFNNSILPVHYDHANGHSQLVIERVTKEDSGTYTCVAENRV
GTIKSLGFVSILEPPIIDGDLRSNRIEPLGGNAVLNCEVRGDPPPTIRWSKNGIHITIGD
RIRQLNNGSLAIYGTVSEDAGSYTCVATNDAGAVERSVTLTLQRAPTITEEPVGTVVDAG
STVVLNCQAEGEPTPTIEWSQQGRPLLGNDRFSSLSNGSLRISSVQKEDTARYECVARNL
VGSVLARVPLTVRVHGGFSEWAEWGLCTVSCGTGAQKRLRRCNNPLPANGGRRCVGPDTE
TRGCQGKPCPVDGNWSEWSAWEECSRTCGQGNRTRVRTCTDPPARHGGRLCEGKPVEVIL
CSVRPCPVAGNWGPWLPWSPCSETCGKGMQTRIRLCNDPPPAFDGPHCDGSDAQTQVCKE
SFCPVDGKWSSWVSWGACAVSCGGGTRQRTRLCASPAPQHGGRQCEGNDVHIDFCNSDPC
PISGNWGPWSNWGSCSKTCNGGQMRRYRTCDNPTPANGGKACAGGDTQTQRCSTATCPVD
GSWGSWQLWGECSASCGGGQRSRLRLCNSPSPSHSGRPCPGDSSQLSRCSTQPCPGGPQK
ARGNIIGSINDIDFGIAILNATMTTSQTGSRVIKATISNIPRTLGPAMRKLVSILNPIYW
TTAQEVGEAANGYTLTQGIFRRETQVEFATGEILRMTHIARGLDSDGGLLLDIVVNGHVL
QLPSHAGIVIKDYTEDYIQTGPGQLYALSTRMFSVDRESVPYSWNHTITYDSSKGKMPYL
VEMLRATAIRADYHPLEEMLEYSIQASILKGDRSNQCPHGFSLAPAGPYCADENECEVGN
PCSHACHNAVGTYHCSCPRGLTISADGRTCQDIDECSLEGHVCHNGQDCENTIGSYRCVM
RCGRGFRRTADGLSCTDINECQESHPCHQHCLNTVGSYRCACEPGFYLRNRRCIDINECR
QRVCRLDQQCRNTRGGYSCIDLCPSGLTKAANATCVDIDECRDGTHQCRYNQVCENTRGS
YHCTCPRGYRSQGVGRPCVDINECEAKDVCQHECVNTPGSHRCLCPAGYRLMANGKTCQD
IDECLEEKIQCGANQMCFNMRGSYQCTETPCPPNYQRDPTTGFCLKNCPPNDLECALSPY
AVEYKLLALPFGIAANQDLIRLVAYTQDGVMHPRTTFLGVDEDATLPFALRDENMKGVLF
TTQALREPRTYRMKVRALSYSPDGGIEYQTTFIVYIAVSIYPY
Download sequence
Identical sequences H3DL88
ENSTNIP00000021286 ENSTNIP00000021286 99883.ENSTNIP00000021286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]