SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021437 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021437
Domain Number 1 Region: 7-183
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.35e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 185-285
Classification Level Classification E-value
Superfamily E set domains 5.25e-29
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021437   Gene: ENSTNIG00000018271   Transcript: ENSTNIT00000021672
Sequence length 301
Comment pep:novel chromosome:TETRAODON8:11:8281545:8284239:-1 gene:ENSTNIG00000018271 transcript:ENSTNIT00000021672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPSLEWPIPSKSGQYQLFIQQQPRSHHRAHYETEGSRGAVKTPNGGHPEVQLFGYQGAD
QLGLQVFIGTADEKLLKPHAFYQVHRITGKTVTTPSVEKMVSGTKLLEIPLEPKNNMRVV
IDCVGILKLRNADIELRNGETDIGRKNTRVRLVFRVHIPQPGGQLLSLQVASDPIECSQR
SAQELPSVERQDLDRCSVLGGQQMVLTGLNFTADSKVIFSEKTQDGKQIWEVEATVDRDK
TQANMLFVEVPPYRDRFISHPAKVNFFVINGKKKRSQPQHFLYTPVIVAAIKAEPLDDSQ
L
Download sequence
Identical sequences H3DLN9
ENSTNIP00000021437 99883.ENSTNIP00000021437 ENSTNIP00000021437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]