SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021494 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021494
Domain Number 1 Region: 590-622,678-762
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000222
Family SPRY domain 0.03
Further Details:      
 
Domain Number 2 Region: 216-280
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000244
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 427-539
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000353
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 4 Region: 24-68
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000164
Family RING finger domain, C3HC4 0.032
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021494
Domain Number - Region: 168-202
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00534
Family TFIIH p44 subunit cysteine-rich domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021494   Gene: ENSTNIG00000018326   Transcript: ENSTNIT00000021729
Sequence length 785
Comment pep:novel chromosome:TETRAODON8:8:8090506:8095553:-1 gene:ENSTNIG00000018326 transcript:ENSTNIT00000021729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAELQTFTAIMDSLVRISSNMKNMEQELCCPVCDGMVKQPILLPCQHSVCLLCAAEVL
VQRGYPPPDLPPEPHSPASTPNSRSPRQARRPTPRTPDRLERVLRTACGTYPGRRRKDAA
PPPMLFPCPSCRQDVELGEKGLAECLRNLTLERIVERYRHTLSLGSVAIMCGFCKPPQSL
EATKGCADCKSNFCNECFKLYHPWGTPRAQHEHILPTNNFRPKVLTCAEHEQERMQWHCH
NCQRLLCPLCKLRRVHHGHRVLPIAQAYQDLKDKVTKEVNFILANQETIQSQITHLDDAI
KQMEANSTAVVRQLSHCVRELGAAVAERQGALSVALEGSRSRKEEALSAQLSGKRSLLEH
AGLMVYTQELLKETDAPCFVQAARITHKRLAKAIEKLQRFSLAADPAFRHFHSDASKEVK
LIQGLEFIRAPLAPVIDTQKTLAYDQLFLCWRLPQDSAQAWHFSVEYQRRAGGAAATWGG
ARSPGAAAAWQRLDEVKGTSAVVDRLQIDCIYVLRVRGCNKAGFGEYSEEVYLHTPPAPV
LSFSLDSRWGLHADRLALGKGQTYARSVPGLSLLQAADRTLTSCHLTSDLLVADVSVSQG
KHYWACSVEPGSYLVKVGVGQESKLQEWFHLPEDMTSPRCEPDSGHDSGAEESQDSPPFC
FLTVGMGKILLPRGAGHSHSQADSHSQTGLHSHSSSQGHAAHVHTAPLPPRLGVCLDCDK
GRVAFYDAHSLRVLWEGHLDCSSPVCPAFCFIGGGALQLQDLVANRSVEEVPPRRVTIQT
RAKNV
Download sequence
Identical sequences H3DLU6
99883.ENSTNIP00000021494 ENSTNIP00000021494 ENSTNIP00000021494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]