SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021512 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021512
Domain Number 1 Region: 23-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-34
Family Pentraxin (pentaxin) 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021512   Gene: ENSTNIG00000018344   Transcript: ENSTNIT00000021747
Sequence length 225
Comment pep:novel chromosome:TETRAODON8:8:7829012:7830095:-1 gene:ENSTNIG00000018344 transcript:ENSTNIT00000021747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKLQMEKLLLFLVVIAPCWTADLSGKVVIFSRESNSDHVKLKTSKTALSSVSTCLRFKT
DLTRAYSLLSVATASHFNDFLLFKPETSAVRVHARDDMADFQSLVLAPNTWHSMCSTWNA
ENGLAQLWLNGSPTIKRFIKTGQITGALSAILGQDQDTFGGGFDAKQSFVGMLHNFHMWD
HVLPASEIRQYMNGMYFTPGNVFSWKDLQYELSGSVFIENVADVV
Download sequence
Identical sequences H3DLW4
99883.ENSTNIP00000021512 ENSTNIP00000021512 ENSTNIP00000021512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]