SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021621 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021621
Domain Number 1 Region: 400-617
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.83e-77
Family Fibrinogen C-terminal domain-like 0.00000118
Further Details:      
 
Domain Number 2 Region: 225-316
Classification Level Classification E-value
Superfamily Fibronectin type III 3.17e-19
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 137-226
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000148
Family Fibronectin type III 0.00081
Further Details:      
 
Domain Number 4 Region: 322-400
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000465
Family Fibronectin type III 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021621
Domain Number - Region: 50-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family Integrin beta EGF-like domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021621   Gene: ENSTNIG00000018448   Transcript: ENSTNIT00000021856
Sequence length 624
Comment pep:novel chromosome:TETRAODON8:8:6454190:6458591:-1 gene:ENSTNIG00000018448 transcript:ENSTNIT00000021856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHKISLLPGGCSGGCETEMTALKERVARLEREMASFKDNCPCSANCPNNCSGNGECQKG
KCFCQDGFTGPDCSKCVQGVECMKSKLEKNGTKLYEFLKESLICTTDVAEAVKGKAKPAA
ETVMVQGSKIHRVAAVTGPEPATEMVFSNVTESSLSVSWSKPKTTYAAFRITYTNIVTGE
YQFVNVNAQESHVVLTKLSAGTSYIVSVMATQGRAQSDALTSIITTVPAPPTHLRVVNVT
DTKALLQWTPSLGKVDRFIISYESSKTPNVTVNVMLAGNSVEHQLRGLQRGTVYTIKVLS
QKNSHQSMAVSTTFTTANLVKANEVGARYAVIAWRTSTVIYHSYRLMYQVAGEETKEVIL
DGTMTEYKLTGLLPVSRYIVLVQGEREGRYTSIVTTEFITENLRFPFPSDCSQELLNGAL
GSGEVDIYPLGKEGRSVRVYCDMETDGGGWTVFQRRLNGKMDFYRTWSEYSAGFGNLSEE
FWLGNDVLYNLTSVSPMSLRVDMRYGNDTVYAHYANFSIDSKERHYALTVSGYTGTAGDS
MRYHNGRPFSAWDKNPDPLGIHCARSYMGGWWYKNCYKTNLNGLYDTNHNNKGIVWIDWK
GKDVSIPFTEMKFRPLRFSPATHG
Download sequence
Identical sequences H3DM73
99883.ENSTNIP00000021621 ENSTNIP00000021621 ENSTNIP00000021621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]