SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021638 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021638
Domain Number 1 Region: 584-849
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.33e-89
Family Eukaryotic proteases 0.00000474
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-28
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 3 Region: 225-331
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-25
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 4 Region: 485-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 82-164
Classification Level Classification E-value
Superfamily SEA domain 0.000000000811
Family SEA domain 0.0068
Further Details:      
 
Domain Number 6 Region: 523-558
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 7 Region: 451-487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021638   Gene: ENSTNIG00000018464   Transcript: ENSTNIT00000021873
Sequence length 850
Comment pep:novel chromosome:TETRAODON8:8:6213231:6224625:1 gene:ENSTNIG00000018464 transcript:ENSTNIT00000021873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNRHTVKRLSSVVKQRGVTGTYFCLLQGQNGHHERIDFLTSQEKKPSKQKRGILIGVLVG
LFLLAGLAALLVWLFVCNKLRRPSTKVFSGHMKLADVEYSQILENTESTDFKDLAGTLQE
TLGTTYKNDTFLSKYHTKSVVTAFSEGVIAYYWSQFDIPVHDLEILPIFSEERVLSVLEN
NIVRTRSTQGSVRIREVTASLTDSRMARNPTAHDCFFRLEAEEQEKMFSSPGYPVKYPPR
SRCQWQIRASEENAISVSFPFFHIEDDCSDDFVSIYDSLSPDDSQAITEKCGQRPPSNPL
EVTSSGNIMLINLITDSEVQQPGFLARYSAIPKSNATTCGGVLTADTGVITSPLYPSSYP
PAVDCKWTIKVPAGRNVRIKFTLFRMKEPGVDTRVCHKDFVEVMGTKYCGEIPYFTLTTN
ENVLDVKFHSDGSYTDKGFSAEYSAFDPSNPCPNKFACNSGRCISKELRCDGWNDCGDMS
DEMMCQCEKDQFACKNGLCKPNLWVCDRVNDCGDWSDEAKCSCEKNEFRCSSGLCLPQDV
VCNQKRDCVDGSDEANCETSAAKGTCSEFTYMCKNQVCINKLNAECDRVNDCSDSSDEAA
CGCGTRPYKLNRIVGGQNAEVGEWPWQVSLHFLTYGHVCGASIISERWLLSAAHCFVTSS
PQNHIAANWLTYSGMQDQYKQDGILRRPLKRIISHPDYNQMTYDYDIALLELSEPLEFTN
TIQPICLPDSSHMFPAGMSCWVTGWGAMREGGQKAQLLQKASVKIINGTVCNEVTEGQVT
SRMLCSGFLAGGVDACQGDSGGPLVCFEESGKWFQAGIVSWGEGCARRNKPGIYTRVTKL
RKWIKEQIGI
Download sequence
Identical sequences H3DM90
ENSTNIP00000021638 99883.ENSTNIP00000021638 ENSTNIP00000021638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]