SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021898 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021898
Domain Number 1 Region: 312-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-50
Family SPRY domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 23-85
Classification Level Classification E-value
Superfamily RING/U-box 2.19e-17
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 101-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000748
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021898   Gene: ENSTNIG00000018719   Transcript: ENSTNIT00000022134
Sequence length 491
Comment pep:novel chromosome:TETRAODON8:19:647057:658308:1 gene:ENSTNIG00000018719 transcript:ENSTNIT00000022134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPAPPGPPQQVVMSSPCCLLTEDQLLCDVCLEVFSEPVSLPCGHTFCRACVEQHWEDSV
QHHCPTCKEIFSAPPQLRTNRFISDVSLLFRGAQRNPQLAKGGDISICPRHQKPLELFCR
TDQSCGCMLCPVQDHKSHDIGLLRDQYENFSESKASVFSHFCAKSLKSRTRLKKEQAEND
LQPSEDRRKELMEEFEQMIHDRRTKMEEIRRSAAVSRKSAERYISESESTFQVLLQTLRR
SQIDLIADLQEKQKDAQRQALPMIRTTVDWAEVSVPPPPYGRKVASTFQDLEERLIKEKE
KLVARSKLLRAQEFFRDVSLDPDTANPFLVLSADGKRVHCGGVCQNLADNPRRFQTACNV
LGWPGCSSGRFYFQVQVEALASWDVGVARESVPRRGPITTSPQNGFWTIGLRDKTQYKAP
GLELRPVEPPKKVGVLVDYEDGRVAFFNVDSAHLLHQFTQCCFSEQLLPFFSPGRRSHCP
NPPSLVICPIS
Download sequence
Identical sequences H3DN00
ENSTNIP00000021898 ENSTNIP00000021898 99883.ENSTNIP00000021898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]