SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021959 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021959
Domain Number 1 Region: 310-429
Classification Level Classification E-value
Superfamily TIMP-like 4.71e-18
Family Netrin-like domain (NTR/C345C module) 0.013
Further Details:      
 
Domain Number 2 Region: 2-48
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021959   Gene: ENSTNIG00000018777   Transcript: ENSTNIT00000022195
Sequence length 444
Comment pep:novel chromosome:TETRAODON8:5:12498544:12505376:-1 gene:ENSTNIG00000018777 transcript:ENSTNIT00000022195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWSAWSGWSVCSRSCGSGASVRTRTCITRNPVGAPCAGDPRQYKICNTKECPPSSEDFRE
MQCAAFNDRPLVAGNSFKWTTFDGGSNPCELSCLALGHNFYYNFGRVLDGTSCNKEPGGV
CVNGRCLKPGCDAILGSQQQEDACMVCGGQNSTCMHHKSVYQSNSLQAGGPFGYSEVAMI
PAGATHIRVTDNSRNYLALQNGRSQFVINGDWKISIPGEYSIAGTKLLYRRSADTWESFE
VPGPTREDLHLMVLATDRNPDIQYEYWLPPEQYALYHGRKSPLRQAHHTSYLPWDQPVTA
ATPPISTRAHGGNCGKCQRVRGRSERRRQYCQKDFVFRARIVGKVYRGEETRYDVQVIHT
YRNSFRLEHREFLWAPNLCDCPRLETGKQYILMVRRHINYERTLNRILLEEDSFVVPYRP
REDDLLRQHERLCGNRGQKHAEQS
Download sequence
Identical sequences H3DN60
ENSTNIP00000021959 99883.ENSTNIP00000021959 ENSTNIP00000021959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]