SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021970 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021970
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily RNI-like 5.76e-24
Family 28-residue LRR 0.00046
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021970
Domain Number - Region: 125-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0712
Family SPRY domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021970   Gene: ENSTNIG00000018788   Transcript: ENSTNIT00000022206
Sequence length 155
Comment pep:novel chromosome:TETRAODON8:5:12434684:12435494:1 gene:ENSTNIG00000018788 transcript:ENSTNIT00000022206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLSDSGLSSRSCQALVPVLSSKTCSLRELDLSNNDLYDAGVTQLSVGLTSPSCRLDTLRM
SGCLIGENGCRSLFLALQSNPAHLKELDLSFNHPGDAVLDLLSAAVLDPRWKLETLKYSQ
TQKRSAWILPASVFCQFSLDPNTAATNLQLSENNR
Download sequence
Identical sequences H3DN71
ENSTNIP00000021970 ENSTNIP00000021970 99883.ENSTNIP00000021970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]