SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022015 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022015
Domain Number 1 Region: 500-760
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.95e-93
Family Eukaryotic proteases 0.0000483
Further Details:      
 
Domain Number 2 Region: 26-129
Classification Level Classification E-value
Superfamily SEA domain 8.76e-17
Family SEA domain 0.0039
Further Details:      
 
Domain Number 3 Region: 294-399
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-16
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 4 Region: 168-283
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000733
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number 5 Region: 406-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 6 Region: 440-472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022015   Gene: ENSTNIG00000018830   Transcript: ENSTNIT00000022251
Sequence length 762
Comment pep:novel chromosome:TETRAODON8:18:10283710:10290341:1 gene:ENSTNIG00000018830 transcript:ENSTNIT00000022251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLFVVILIILIITGAALAWYFLDYRVWVLEPRVQQQYVVYLSILNRNFSADLSSHTSPTF
KREARGVQSTVEKVMRSSSLSRYFNYTTVFAFGEGSVVAHLWLVMSVPSSHVGAITVEKL
SKSLQKGLERAFKSLFWYHISYPLLVPNSKWYLNSYLNILVIFYSPLDCYRYQRVLSSSP
VALRGPDTQRSTCMWHLQAAPGTQLELQMEWLLPECRDRLLVYNSLTPTDTHLITSVYGC
SRHEPVVRVLSSGEWMTVLWKQGLYNYKDPFSLSAQAWEHQDCNSTVELRAVLGVQGSLK
TPFYPSYYPPDTNCTWTFNMPAVGMGLSLEFEGYELSRAGYQQDCTQGQWIIQNRRLCGT
RGLQPYTERLFLPSSTATVVMTSEVSLTGPGLQLHYKVFNLSDPCPGQFLCTTNGLCVSA
CDGIKDCPTGLDERNCVCVAQFQCLEDSQCVDYYKVCDQHPDCSEASDEDPCQESVACTD
MTYMCADGTCLKKPNPECDFVTDCPDASDEKQCDCGLRQFSSRIVGGTNATEGEWPWQAS
LQVRGNHICGGALISSQWVVSAAHCFYDDRLYSPSMWTVYLGKLLLNRGSPTEEVARVQQ
IHLHPYYDDDSHDYDLALLKLERPAGAVLAGHARPACLPPPTHQLEPDLLCWVTGWGSLQ
EGGRASNVLQKVDVRLVSEDACIRSYGHLVTPRMLCAGYRSGEKDACQGDSGGPLVCQEP
SGRWFLAGVVSWGRGCGRPDYYGVYTRITRLTGWIKEVIGSP
Download sequence
Identical sequences H3DNB6
ENSTNIP00000022015 99883.ENSTNIP00000022015 ENSTNIP00000022015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]