SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022026 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022026
Domain Number 1 Region: 353-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.88e-35
Family Pentraxin (pentaxin) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022026   Gene: ENSTNIG00000018841   Transcript: ENSTNIT00000022262
Sequence length 558
Comment pep:novel chromosome:TETRAODON8:18:10140215:10148053:1 gene:ENSTNIG00000018841 transcript:ENSTNIT00000022262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLSPPAIALRATMPHPPGLHAAPRPRCLSCRPTNGFVSIPPAAMKFMVVLVGAGALAFL
GAVICIIASVYPRKRAAPLSDNGTLTSETLLQPLEPGSVAHAGPLGALHGAESYGGGNGL
GGIGLEVLQPPDLHACPGRRLQQQRHEAAAGAAPAGGRPAVWSRGRRLDAPAEHRRGVRQ
MVLQQNDQILMDHRTIRELTGKLSECESGLEDERNVPERSVNVWSANRRVMAGDDVSSSA
AAQLQTARAVEELARAIMDLQDRIEKLEAEIGPAVLNLTDSPLAPPGRAKSTWRVEDLEG
ELERKIKMLEKERQAMRKETQGQQEKINQGLDTVNHRITELEHTLVEPSFPEGFVLSFPM
RTNYMYGLVRKEITEMYAFTACLWLKAKEGGIGTPFSYSVPGQTNELVLLQGVRSPVELL
INDKVAQLPLSLPQDQWQHICVSWTLRDGVWKAYQGGKLKGRGEGLAAWHPIKPGGVLIL
GQEQDTLGGQFDASQALVGELSQFNLWDRLLKPAEVAALADCSSSALGNIAPWTDQDVDV
YGGATKESLDPCHAAQRS
Download sequence
Identical sequences H3DNC7
99883.ENSTNIP00000022026 ENSTNIP00000022026 ENSTNIP00000022026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]