SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022042 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022042
Domain Number 1 Region: 4-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-69
Family Lectin leg-like 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022042   Gene: ENSTNIG00000018857   Transcript: ENSTNIT00000022278
Sequence length 293
Comment pep:novel chromosome:TETRAODON8:12:12016145:12017999:-1 gene:ENSTNIG00000018857 transcript:ENSTNIT00000022278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEEFLKKELSLAKPYRGLGFSSSSQWDLMGTAMVTPDYVRLTPDLQSRQGAVWSRVPLFL
RDWELKVHFKIHGVGKKNFNGDGLAIWLTKDRMQNGPVFGNMNQFTGLGVFVDTYPNADR
LHDRSYPYVSVMLGNGTLSYDHDRDGRPTELGGCSALVRNAVHDTFLLVRYSGNRLRLMV
NVDGQQDWKDCADVAGLRLPTGYFLGASSATGDLSDNHDIVSLKLYQLTVQRSVTIPRVD
NINLFQVEVQDEGTSGLQLFFSLLVSVLGLGVLAVVGAVVYGRWKQNRRKRFY
Download sequence
Identical sequences H3DNE3
99883.ENSTNIP00000022042 ENSTNIP00000022042 ENSTNIP00000022042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]