SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022098 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022098
Domain Number 1 Region: 930-1099,1147-1220,1288-1387
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.21e-115
Family Mammalian PLC 0.00000437
Further Details:      
 
Domain Number 2 Region: 1676-1781
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-37
Family Ras-binding domain, RBD 0.00000992
Further Details:      
 
Domain Number 3 Region: 79-278,306-368
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-35
Family Ras GEF 0.0055
Further Details:      
 
Domain Number 4 Region: 1414-1524
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.72e-21
Family PLC-like (P variant) 0.0029
Further Details:      
 
Domain Number 5 Region: 1549-1653
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.88e-19
Family Ras-binding domain, RBD 0.00039
Further Details:      
 
Domain Number 6 Region: 745-777,855-918
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000129
Family EF-hand modules in multidomain proteins 0.025
Further Details:      
 
Domain Number 7 Region: 415-553
Classification Level Classification E-value
Superfamily PH domain-like 0.0000307
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022098   Gene: ENSTNIG00000018911   Transcript: ENSTNIT00000022334
Sequence length 1802
Comment pep:novel chromosome:TETRAODON8:2:8281634:8305838:-1 gene:ENSTNIG00000018911 transcript:ENSTNIT00000022334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRACLQRTSVFSLLTGALLEAVAALGARSALPYPLPQGTGHNSHAVLKERQLANSMTSSS
ALSPAVSGISKELSEMRHLVQFPEEIACILTEQEQQLYQQVFPLDYLRFLTKDLGSPECQ
SKHHPSLKASLSVPAMSTQSSRHNAVEDLVARFNEVSSWVTWLILTAGSMEEKREVFSYL
VHVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMDQTDIETMRSLKDAMAQHESSSEYK
KIVTRARNIPGCKVVPFCGVFLKELNDALGGTASIISLKPSLDNAEDSFEFVSDYSGQQN
FLLRSGPDGLHIPEKEATVSNILQIIRSCNRSLEVEDIDEGSTSPSSSCPLPTSRNNSFR
DRCRNQFMMGDLSDSDGDTPSEPAVKEVEFQGTEETHRAFHGTELIPWYVLSLQPDVHQF
LLQGATVIHYDQDSHLTARCLLRLQPDNTTLTWGNPHSRGASLTEPPLGLGQTVVAGLAE
GLLDFGVVKAVFLGHQGVDVHAVCLQNKLSHMTVEENALSLLYGVSTTDNRLLHFVAPNH
TAQMLHKGLSELVKATRKLKKFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAIELFGGRR
WNMNTGGTEKATHQKNSPLSINDKTKKKKKAIVRGDSGDATDDEMVSRKTRSCKEGLYRN
GPESDSIDQDDPAEISVFVEDGFPGPFSLAANKSPGLSMTGSNPSRPQSSPTLSGTVKAQ
PGAWSSRSWHGRGKGCFRGFQNLMISDSTMSFVEFVELFKSFSIRSRKDLKELFDTFAVP
CSRSNPESAPLYTNLRIDDKDTGLQPDLDLLTRNGSDLGLFIRTRQQMSDNQKQISDAIA
AASIVTNGTGVENASLGVLGLGIPQLNDFLVNCQREHLSYDEILNIIQKFETSSSMRQMG
WMSFEGFSRFLMDKDNFASCIDESQMNQEELRYPLSYYYIQSSHNTYLTGHQLKGESSVE
LYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAISRSAFVNSNMPVIL
SIENHCSLPQQRKMAEIFKTVFGERLVTRFLFDSDFSDDPHLPSPLQLQGRILLKNKKLK
AHQAPVDILKQKAHQLAHMQAQVSNGSPTVSSPGNHTNEDEEEEEDEYDYDYESLSDDNI
LDDKPEVKSSADKEEQPVDEIPKRIKKSDHTTQSKGKVFDMELGEEFYLPQNKKESRQIA
QELSDLIIYCQAVKFPGLSTLSPAGSSRGKDRGKSRKSIFGTAPARCSTPGETTTPCRTP
GKGGAERLSWEEQQSSPVPSPPTSLSAIIRTPKCYHISSVNENAAKRLCRRYSQKLIQHT
ACQLLRTYPAATRIDSTNPNPLLFWLHGIQLVALNYQTDDLPMQLNTSLFEANGGCGYVL
KPAVLWDRNCLNYQQFCPMERDVEKMSPAVYSFTIVSGQNVCPGNSSGSPCIEVDVLGMS
VDSAHFRTKPIHRNTLNPMWNEHFQFTVHFEEMCFLRVAVVENNSSQTTAQRTLPLKALK
SGYRHIQLRTQHNEFLEVSSLFVYSRRQRENCPGPPKTISHLFSSKEKRVSQQHKVTVYG
APGPEPFAVFSVTEQITAKQLLDVVSSFQNHSFCWWKSYFLCEEKVPLLKERRSAKRCSQ
HRPLAPEEEVVRLISSWSTEEGYVGRICLKLREEKFNEKMAVSEGEEESSTGAARDDVFL
VQIHEVSPEQPHTVIKAPRYSTAQDIIQQTLSKAKYSYSIVSHPNPCDYVLMEEVTKDVG
SKKSSTTKPPQRVLLDHECVYQAQSRWRGTGKFILKLKEQRQLVREDKKKVISFASELKK
LT
Download sequence
Identical sequences H3DNJ9
ENSTNIP00000022098 99883.ENSTNIP00000022098 ENSTNIP00000022098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]