SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022149 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022149
Domain Number 1 Region: 38-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-36
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022149   Gene: ENSTNIG00000018962   Transcript: ENSTNIT00000022387
Sequence length 421
Comment pep:novel chromosome:TETRAODON8:Un_random:10541058:10554829:-1 gene:ENSTNIG00000018962 transcript:ENSTNIT00000022387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRWSLRWKTKRWIMDSTLTAFITLFLVLQAARVKAAEPVDVLKVLEFQNNPEGVERTSG
FCVQRRASKPDSAYRVSKPFQISAPTTQLFPDLAGGVFPQDFSILTTLRAKPGLQSFLLS
IYNEQGVQQLGVEVGRSPVFLYEDQNGKPAPEDYPLFKAFSLADGKWHRVAISVEKNTVT
IILDCKKKLTKPLPRSDNASIDTNGITVFGTRFLDADVFQGDIQQLLIADNPGAAYNYCE
HIPDCETPHSDSMQAQEPEKEPNNVEGDYNTDIDFGTLDDTQTQSPFTTSGPNEEDAVGE
FVTEATPFASEPTIVPETVDELDTGTDAYDFKEYDLKEYDLGEVDGRLYDYGAYDEYGTA
TPKLTATEDEVGPGVAAETDISENTIAGIGEAFGQKGEKGEPAVIEPGMLIEGPPGPPGP
S
Download sequence
Identical sequences H3DNQ0
99883.ENSTNIP00000022149 ENSTNIP00000022149 ENSTNIP00000022149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]