SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022293 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022293
Domain Number 1 Region: 45-194
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.47e-24
Family Growth factor receptor domain 0.0012
Further Details:      
 
Domain Number 2 Region: 196-250
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022293   Gene: ENSTNIG00000019099   Transcript: ENSTNIT00000022532
Sequence length 308
Comment pep:novel chromosome:TETRAODON8:8:3585601:3595023:1 gene:ENSTNIG00000019099 transcript:ENSTNIT00000022532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLQLISFALIILHCMDYTGCQPHSSSRHWQHKQISGVSSGCQQGGCLTCSDYNGCLSCK
PRFFMHLERIGMKQIGVCMTSCPPGFYGTRFPERSPCTKCRSECDSCFARNFCTRCRAGF
FLHLGKCQETCPEGLVRNEAQRECAPKCPADCESCVNSDTCTRCRQGLYLLSGRCHHVCP
EDYEPSDKLMECTPQVHCEVGEWSEWSPCSQSGRTCGFKRGQETRTRQVLRYPSPFGNPC
PDISEIKECLLKKRKCPGGRRKGERKERLNRNNRKDKENQTGEREDSDNRNKTEHRHRRG
HDPDLAWP
Download sequence
Identical sequences H3DP44
99883.ENSTNIP00000022293 ENSTNIP00000022293 ENSTNIP00000022293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]