SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022444 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022444
Domain Number 1 Region: 621-689,920-1256
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-120
Family Ras GEF 0.000015
Further Details:      
 
Domain Number 2 Region: 222-444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-45
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 3 Region: 23-128
Classification Level Classification E-value
Superfamily PH domain-like 8.99e-20
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 
Domain Number 4 Region: 482-589
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000157
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022444   Gene: ENSTNIG00000019244   Transcript: ENSTNIT00000022683
Sequence length 1258
Comment pep:novel chromosome:TETRAODON8:13:2728485:2741390:-1 gene:ENSTNIG00000019244 transcript:ENSTNIT00000022683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVTYLGLLAKKDGTRRGCLSKKSSDNTKWHTKWFALLQNMLFYFENESSS
RPSGLYLLEGCICDRAPSPKPSQSAKECLEKQYYFTISFTHENQKALELRTEDVKDCDEW
VAAISHASYRNLANEHESLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAG
LLKDNEKIHASPAAAPSDDDSEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRK
RNQVVFSMLDSEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHIERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQDKGSLIQVPMSEKGKITRGR
LGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVVSLIDCTLMEDPEGTDDESKS
DKTGQDMEHLDFKIVVEPKDSQSFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAF
EDNSKVTVPQMIKSDSSLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSID
FLNTFLHSYRVFTTADVVLDKLITIYKKPISAIPARSLELFFASSQNSKLLYGEPPTSPR
ASRKFSSPPPLAIAKNSSPNRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSSMSPF
SKTTLDINKLYVSSPIASKIPDEGEDRKDKMEDAPASKQDLSVREESDNDPNQSDDADPE
ASPTKSPTTPKNIKCKNSSEFSLFSYNNGMVMSSCRELDNNRSALSAASAFAIATAGANE
GTPTKEKYRRMSLASTAGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSPDFETNNE
LKTKVIAFLEEVMHDPELLTQERKAAANIIRTLTQEDHGDNQITLEDATQLVGGKAEPFE
NHSALEVAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMRTTKHFNDISNLIAT
EILRCEDVVTRVAVIEKWVAVADICRCLHNYNAVLEITSSLNRSSVFRLKKTWLKVSKQT
KALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNF
SKMRMISHIIREIRQFQQTAYKIDLQPKVAQYLLDLSFVLDEESMYEASLRIEPKVPN
Download sequence
Identical sequences H3DPJ6
99883.ENSTNIP00000022445 ENSTNIP00000022445 ENSTNIP00000022444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]