SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022782 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022782
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000451
Family N-acetyl transferase, NAT 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022782
Domain Number - Region: 187-233
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0213
Family Transglutaminase, two C-terminal domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022782   Gene: ENSTNIG00000019552   Transcript: ENSTNIT00000023023
Sequence length 320
Comment pep:novel chromosome:TETRAODON8:Un_random:25511485:25513148:-1 gene:ENSTNIG00000019552 transcript:ENSTNIT00000023023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTMPQLPESLSQTGLQFTLATEEDFDDIMAMSQDIYGGLDYLPTRYSSWLKEANRTVILA
RKQGKVIALESVCVIDNGETMLVEGLRVAPQERGKGVAGVLLRFCSELVKSKFPDVKVTR
LTRDDQLGPKDFQKYRIITKQQTLPQSSKFTTYISMLYNWKFGNAPKVIFCPHFAHFCAF
QVVNCCKIQLMSNRKQMQTPTLHILLHNALCLVLSNCTLVLSSLCIFSFAVICETGFYPS
PLLVKMYYLNIDMFGKDLALVRQQFLAHLQCHTASLKGHVMCQMFLDPPLWKPMAEFCRN
TLGVELVKEYTEQCVVESEV
Download sequence
Identical sequences H3DQI3
ENSTNIP00000022782 99883.ENSTNIP00000022782 ENSTNIP00000022782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]