SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022790 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022790
Domain Number 1 Region: 1-223
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 7.33e-82
Family Fibrinogen C-terminal domain-like 0.00000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022790   Gene: ENSTNIG00000019559   Transcript: ENSTNIT00000023031
Sequence length 226
Comment pep:novel chromosome:TETRAODON8:Un_random:97281351:97282536:-1 gene:ENSTNIG00000019559 transcript:ENSTNIT00000023031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCSDVFADGNVASGVYVIRPDGSPTALSVYCDMNNGGGWTVFQRRRDGKENFDRAWVEYK
HGFGDMFSPEGEFWLGNEPLHHLTLQGNYELRIDMEDFDGNQRYAEYKNFLVDDEEDEYQ
LHLGEYTGNAGNALVNTQMSPPEEEAWSVPGIKFSTYDHLNDSDSRCVRHSRSGWWFSRC
DSGNLNGHYYNGPYQAMTDDGVVWYTWHGWWYSIKSVVMMVRADDL
Download sequence
Identical sequences Q4RDU1
ENSTNIP00000022790 99883.ENSTNIP00000022790 ENSTNIP00000022790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]