SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022875 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022875
Domain Number 1 Region: 32-126
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000366
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022875   Gene: ENSTNIG00000019632   Transcript: ENSTNIT00000023116
Sequence length 242
Comment pep:novel chromosome:TETRAODON8:Un_random:44040821:44042405:1 gene:ENSTNIG00000019632 transcript:ENSTNIT00000023116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGDQPMEDIEGMEEVFATLSAMKTEVELMRRPLGTFESPARTCKELMMVQTNNKDGDYWI
DPNQGCHRDSVKVYCNFTADGETCLYPDKRIEMVKLAAWNKETPGSWYSQFRKGKQFSYV
DSDGNPVDVVQMTFLKLLSATAKQDFTYTCQNSAGWFDKASDSYQHALRFRGSNDEELTQ
AKSPFISVVYDGCQSRKGQERTVLEIDSPSAEILPIMDIAASDFGNSNQKFGFQVGRVCF
NG
Download sequence
Identical sequences H3DQS6
ENSTNIP00000022875 ENSTNIP00000022875 99883.ENSTNIP00000022875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]