SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022930 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022930
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily TAFH domain-like 7.19e-37
Family TAFH domain-like 0.0000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022930   Gene: ENSTNIG00000019685   Transcript: ENSTNIT00000023172
Sequence length 137
Comment pep:novel chromosome:TETRAODON8:Un_random:103123201:103123933:1 gene:ENSTNIG00000019685 transcript:ENSTNIT00000023172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQENVKKCKNFLATLIKLASHNSPSPDTSKNVKALVQDLLDAKIEPEEFTTRLQAELKSS
PQPYLIPFLKKSLPALRQSLLSSQQSLVTTPTPPLAAPGSVTATAIRPRVPISPVGTAVR
LNTPLTSTVVQMSPLSA
Download sequence
Identical sequences H3DQY1
99883.ENSTNIP00000022930 ENSTNIP00000022930 ENSTNIP00000022930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]